Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PHOSPHOLIPASE A2 (MIPLA2) FROM MICROPECHIS IKAHEKA
 
Authors :  S. M. Lok, K. Swaminathan
Date :  02 Jul 03  (Deposition) - 01 Mar 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Phospholipase A2, Micropechis Ikaheka, Pancreatic Loop, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. M. Lok, R. Gao, M. Rouault, G. Lambeau, P. Gopalakrishnakone, K. Swaminathan
Structure And Function Comparison Of Micropechis Ikaheka Snake Venom Phospholipase A2 Isoenzymes.
Febs J. V. 272 1211 2005
PubMed-ID: 15720395  |  Reference-DOI: 10.1111/J.1742-4658.2005.04547.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PHOSPHOLIPASE A2
    Chains: A, B, C, D
    EC Number: 3.1.1.4
    Organism Scientific: MICROPECHIS IKAHEKA
    Organism Taxid: 66188
    Secretion: VENOM
    Synonym: MIPLA2

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1PWO)

(-) Sites  (0, 0)

(no "Site" information available for 1PWO)

(-) SS Bonds  (28, 28)

Asymmetric/Biological Unit
No.Residues
1A:11 -A:77
2A:27 -A:123
3A:29 -A:45
4A:44 -A:105
5A:51 -A:98
6A:61 -A:91
7A:84 -A:96
8B:11 -B:77
9B:27 -B:123
10B:29 -B:45
11B:44 -B:105
12B:51 -B:98
13B:61 -B:91
14B:84 -B:96
15C:11 -C:77
16C:27 -C:123
17C:29 -C:45
18C:44 -C:105
19C:51 -C:98
20C:61 -C:91
21C:84 -C:96
22D:11 -D:77
23D:27 -D:123
24D:29 -D:45
25D:44 -D:105
26D:51 -D:98
27D:61 -D:91
28D:84 -D:96

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1PWO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PWO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1PWO)

(-) Exons   (0, 0)

(no "Exon" information available for 1PWO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:124
                                                                                                                                                            
               SCOP domains d1pwoa_ A: automated matches                                                                                                 SCOP domains
               CATH domains 1pwoA00 A:1-124 Phospholipase A2                                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhh...hhhhhhhee...ee........hhhhhhhhhhhhhhhhhhhh................eeee..eeee......hhhhhhhhhhhhhhhhhh..ee.hhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pwo A   1 NLYQFRKMIKCTIPGREPLLAFTDYGCYCGKGGSGTPVDELDRCCQTHDNCYDKAEKLPECKGILSGPYVNTYSYDCTDGKLTCNDQKDKCKLFICNCDRTAAMCFAKAPYIEANNHIDPNRCK 124
                                    10        20        30        40        50        60        70        80        90       100       110       120    


Chain B from PDB  Type:PROTEIN  Length:124
                                                                                                                                                            
               SCOP domains d1pwob_ B: automated matches                                                                                                 SCOP domains
               CATH domains 1pwoB00 B:1-124 Phospholipase A2                                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhh...hhhhhhh...............hhhhhhhhhhhhhhhhhhhh................eeee..eeee....hhhhhhhhhhhhhhhhhhhh..ee.hhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pwo B   1 NLYQFRKMIKCTIPGREPLLAFTDYGCYCGKGGSGTPVDELDRCCQTHDNCYDKAEKLPECKGILSGPYVNTYSYDCTDGKLTCNDQKDKCKLFICNCDRTAAMCFAKAPYIEANNHIDPNRCK 124
                                    10        20        30        40        50        60        70        80        90       100       110       120    


Chain C from PDB  Type:PROTEIN  Length:124
                                                                                                                                                            
               SCOP domains d1pwoc_ C: automated matches                                                                                                 SCOP domains
               CATH domains 1pwoC00 C:1-124 Phospholipase A2                                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhh...hhhhhh.ee...ee........hhhhhhhhhhhhhhhhhh..................eeee..eeee....hhhhhhhhhhhhhhhhhhhhheehhhhh..hhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pwo C   1 NLYQFRKMIKCTIPGREPLLAFTDYGCYCGKGGSGTPVDELDRCCQTHDNCYDKAEKLPECKGILSGPYVNTYSYDCTDGKLTCNDQKDKCKLFICNCDRTAAMCFAKAPYIEANNHIDPNRCK 124
                                    10        20        30        40        50        60        70        80        90       100       110       120    


Chain D from PDB  Type:PROTEIN  Length:124
                                                                                                                                                            
               SCOP domains d1pwod_ D: automated matches                                                                                                 SCOP domains
               CATH domains 1pwoD00 D:1-124 Phospholipase A2                                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhh...hhhhhh.ee...ee........hhhhhhhhhhhhhhhhhhhh................eee....eee....hhhhhhhhhhhhhhhhhhhhheehhhhh..hhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pwo D   1 NLYQFRKMIKCTIPGREPLLAFTDYGCYCGKGGSGTPVDELDRCCQTHDNCYDKAEKLPECKGILSGPYVNTYSYDCTDGKLTCNDQKDKCKLFICNCDRTAAMCFAKAPYIEANNHIDPNRCK 124
                                    10        20        30        40        50        60        70        80        90       100       110       120
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1PWO)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1PWO)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1pwo)
 
  Sites
(no "Sites" information available for 1pwo)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1pwo)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1pwo
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.1.4
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1PWO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1PWO)