1PPJ - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:442
 aligned with QCR1_BOVIN | P31800 from UniProtKB/Swiss-Prot  Length:480

    Alignment length:442
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475  
           QCR1_BOVIN    36 ATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFW 477
               SCOP domains d1ppja1 A:2-233 Cytochrome bc1 core subunit 1                                                                                                                                                                                           d1ppja2 A:234-442 Cytochrome bc1 core subunit 1                                                                                                                                                                  - SCOP domains
               CATH domains ------------1ppjA01 A:14-227 Cytochrome Bc1 Complex; Chain A, domain 1                                                                                                                                                            -----------1ppjA02 A:239-442 Cytochrome Bc1 Complex; Chain A, domain 1                                                                                                                                                 - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhh.....eeee.....eeeeee....eeeeeeee..hhhhh.....hhhhhhhhhh.........hhhhhhhhhh..eeeeee....eeeeeeee..hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh..hhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee..hhhhhhhhhhhhhh.....................eeeeeee.....eeeeeeeee......hhhhhhhhhhhhheee....hhhhh.hhhhhhhhhh....eeeeeeee....eeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh....hhhhhhhhhhh.hhhhhhhhhhhhh.....eeeeee......hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ppj A   2 ATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFW 443
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441

Chain B from PDB  Type:PROTEIN  Length:424
 aligned with QCR2_BOVIN | P23004 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:428
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445        
           QCR2_BOVIN    26 EAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYHGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL 453
               SCOP domains -----d1ppjb1 B:17-235 Cytochrome bc1 core subunit 2                                                                                                                                                                             d1ppjb2 B:236-439 Cytochrome bc1 core subunit 2                                                                                                                                                              SCOP domains
               CATH domains -----1ppjB01 B:17-227 Cytochrome Bc1 Complex; Chain A, domain 1                                                                                                                                                         -----------1ppjB02 B:239-439 Cytochrome Bc1 Complex; Chain A, domain 1                                                                                                                                               CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .----........eeee.....eeeee.....eeeeeeee..hhhhh.....hhhhhhhhh........hhhhhhhhhhhh..eeeeee....eeeeeeee..hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhh....hhhhh...hhhhhhhhhhhhhhhh.eeeeee..hhhhhhhhhhhhh.................eeeeee....eeeeeeeee.....hhhhhhhhhhhhhhh............hhhhhhhhhhh...eeeeeeeee....eeeeeeeeee..hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh....hhhhhhhhhhh.hhhhhhhhhhhhhhh.eeeeeee......hhhhh Sec.struct. author
                 SAPs(SNPs) ---------------R---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------INSULINASE  PDB: B:54-77-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 5 (1) Exon 5.2      Exon 5.3  PDB: B:26-75 UniProt: 40-89             Exon 5.4  PDB: B:76-97------------------Exon 5.6  PDB: B:116-158 UniProt: 130-172  --------------------------------Exon 5.8            ---------------------------------Exon 5.10  PDB: B:244-310 UniProt: 258-324                         Exon 5.11  PDB: B:311-337  Exon 5.12  PDB: B:338-363 ---------------------------------------------------Exon 5.14  PDB: B:415-439 Transcript 5 (1)
           Transcript 5 (2) -------------------------------------------------------------------------------------Exon 5.5            -----------------------------------------Exon 5.7  PDB: B:158-190         -------------------Exon 5.9  PDB: B:210-244           ----------------------------------------------------------------------------------------------------------------------Exon 5.13  PDB: B:363-414 UniProt: 377-428          ------------------------- Transcript 5 (2)
                 1ppj B  12 E----VPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYHGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL 439
                            |    |  21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431        
                           12   17

Chain C from PDB  Type:PROTEIN  Length:365
 aligned with CYB_BOVIN | P00157 from UniProtKB/Swiss-Prot  Length:379

    Alignment length:365
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374     
            CYB_BOVIN    15 NNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW 379
               SCOP domains d1ppjc2 C:15-260 Mitochondrial cytochrome b subunit, N-terminal domain                                                                                                                                                                                d1ppjc1 C:261-379 Mitochondrial cytochrome b subunit, C-terminal domain                                                 SCOP domains
               CATH domains 1ppjC00 C:15-379 Cytochrome Bc1 Complex; Chain C                                                                                                                                                                                                                                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eee...hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............eeehhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh.............hhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhh.........hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CYTB_CTER  PDB: C:210-379 UniProt: 210-379                                                                                                                                 PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ppj C  15 NNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW 379
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374

Chain D from PDB  Type:PROTEIN  Length:241
 aligned with CY1_BOVIN | P00125 from UniProtKB/Swiss-Prot  Length:325

    Alignment length:241
                                    94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324 
            CY1_BOVIN    85 SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK 325
               SCOP domains d1ppjd1 D:1-195 Cytochrome bc1 domain                                                                                                                                                              d1ppjd2 D:196-241                              SCOP domains
               CATH domains 1ppjD02 D:1-196 Cytochrome c                                                                                                                                                                        1ppjD01 D:197-240                           - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................hhhhhhhhhhhhhhhhhhh......hhhhhh....hhhhhhhhhhh.eeee........eeee............hhhhhhhh.................hhhhhhhhhhh...............ee.......ee...................hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------CYTC  PDB: D:24-125 UniProt: 108-209                                                                  -------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 4 (1) Exon 4.2  PDB: D:1-26     ------------------------------------------Exon 4.4  PDB: D:69-121 UniProt: 153-205             -----------------------------------------------------Exon 4.6  PDB: D:175-208          Exon 4.7  PDB: D:209-241          Transcript 4 (1)
           Transcript 4 (2) -------------------------Exon 4.3  PDB: D:26-68 UniProt: 110-152    ----------------------------------------------------Exon 4.5  PDB: D:121-175 UniProt: 205-259              ------------------------------------------------------------------ Transcript 4 (2)
                 1ppj D   1 SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK 241
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain E from PDB  Type:PROTEIN  Length:196
 aligned with UCRI_BOVIN | P13272 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:196
                                    88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268      
           UCRI_BOVIN    79 SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG 274
               SCOP domains d1ppje2 E:1-69                                                       d1ppje1 E:70-196 ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain                                  SCOP domains
               CATH domains --1ppjE01 E:3-66  [code=1.20.5.270, no name defined]              1ppjE02 E:67-196 'Rieske'-like iron-sulphur domains                                                                                CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh.........hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........eeehhhhh....eeeeee..eeeeeee.hhhhhhhhhhhhhhhh....hhhhh.....eeeee..........ee.....eeeee....eeee....eee...........eeee...eeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------RIESKE  PDB: E:109-194 UniProt: 187-272                                               -- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ppj E   1 SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG 196
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190

Chain F from PDB  Type:PROTEIN  Length:99
 aligned with QCR7_BOVIN | P00129 from UniProtKB/Swiss-Prot  Length:111

    Alignment length:99
                                    22        32        42        52        62        72        82        92       102         
           QCR7_BOVIN    13 WLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYNDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWAKK 111
               SCOP domains d1ppjf_ F: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)              SCOP domains
               CATH domains 1ppjF00 F:12-110 Cytochrome Bc1 Complex; Chain F                                                    CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh.hhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh....hhhhh.hhhhh...hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.2           -------------------------------------------------------Exon 2.4  PDB: F:86-110   Transcript 2 (1)
           Transcript 2 (2) ------------------Exon 2.3  PDB: F:30-85 UniProt: 31-86                   ------------------------- Transcript 2 (2)
                 1ppj F  12 WLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWAKK 110
                                    21        31        41        51        61        71        81        91       101

Chain G from PDB  Type:PROTEIN  Length:75
 aligned with QCR8_BOVIN | P13271 from UniProtKB/Swiss-Prot  Length:82

    Alignment length:75
                                    11        21        31        41        51        61        71     
           QCR8_BOVIN     2 GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA  76
               SCOP domains d1ppjg_ G:                                                                  SCOP domains
               CATH domains 1ppjG00 G:1-75  [code=1.20.5.210, no name defined]                          CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeeeeee.hhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------- PROSITE
           Transcript 6 (1) Exon 6.2b  PDB: G:1-51 UniProt: 1-52 [INCOMPLETE]  ------------------------ Transcript 6 (1)
           Transcript 6 (2) --------------------------------------------------Exon 6.3a  PDB: G:51-75   Transcript 6 (2)
                 1ppj G   1 GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA  75
                                    10        20        30        40        50        60        70

Chain H from PDB  Type:PROTEIN  Length:66
 aligned with QCR6_BOVIN | P00126 from UniProtKB/Swiss-Prot  Length:91

    Alignment length:66
                                    35        45        55        65        75        85      
           QCR6_BOVIN    26 LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK  91
               SCOP domains d1ppjh_ H:                                                         SCOP domains
               CATH domains 1ppjH00 H:13-78  [code=1.10.287.20, no name defined]               CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
               Transcript 3 3.Exon 3.3  PDB: H:15-68 UniProt: 28-81                 Exon 3.4   Transcript 3
                 1ppj H  13 LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK  78
                                    22        32        42        52        62        72

Chain I from PDB  Type:PROTEIN  Length:43
 aligned with UCRI_BOVIN | P13272 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:47
                                    41        51        61        71       
           UCRI_BOVIN    32 AAVPATSESPVLDLKRSVLCRESLRGQAAGRPLVASVSLNVPASVRY  78
               SCOP domains d1ppji_ I:                                      SCOP domains
               CATH domains 1ppjI00 I:32    -78 Cytochrome Bc1 Complex; Cha CATH domains
               Pfam domains ----------------------------------------------- Pfam domains
         Sec.struct. author ............----...hhhhhh.........eeeee....ee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------- Transcript
                 1ppj I  32 AAVPATSESPVL----SVLCRESLRGQAAGRPLVASVSLNVPASVRY  78
                                    41 |    | 51        61        71       
                                      43   48

Chain J from PDB  Type:PROTEIN  Length:33
 aligned with QCR9_BOVIN | P00130 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:33
                                    40        50        60   
           QCR9_BOVIN    31 FFERAFDQGADAIYEHINEGKLWKHIKHKYENK  63
               SCOP domains d1ppjj_ J:                        SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh...hhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------- PROSITE
               Transcript 1 Exon 1.1            Exon 1.2      Transcript 1
                 1ppj J  30 FFERAFDQGADAIYEHINEGKLWKHIKHKYENK  62
                                    39        49        59

Chain N from PDB  Type:PROTEIN  Length:442
 aligned with QCR1_BOVIN | P31800 from UniProtKB/Swiss-Prot  Length:480

    Alignment length:442
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475  
           QCR1_BOVIN    36 ATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFW 477
               SCOP domains d1ppjn1 N:2-233 Cytochrome bc1 core subunit 1                                                                                                                                                                                           d1ppjn2 N:234-442 Cytochrome bc1 core subunit 1                                                                                                                                                                  - SCOP domains
               CATH domains ------------1ppjN01 N:14-227 Cytochrome Bc1 Complex; Chain A, domain 1                                                                                                                                                            -----------1ppjN02 N:239-442 Cytochrome Bc1 Complex; Chain A, domain 1                                                                                                                                                 - CATH domains
           Pfam domains (1) ----------------------Peptidase_M16-1ppjN01 N:24-171                                                                                                                      ----Peptidase_M16_C-1ppjN03 N:176-361                                                                                                                                                         ---------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----------------------Peptidase_M16-1ppjN02 N:24-171                                                                                                                      ----Peptidase_M16_C-1ppjN04 N:176-361                                                                                                                                                         ---------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author .hhhhhhhh....eeee.....eeeeee....eeeeeeee..hhhhh.....hhhhhhhhhhh........hhhhhhhhhh..eeeeee....eeeeeeee..hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee..hhhhhhhhhhhhhh.....................eeeeeee.....eeeeeeeee.....hhhhhhhhhhhhhheee....hhhhh.hhhhhhhhhhh...eeeeeeee....eeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh....hhhhhhhhhhh.hhhhhhhhhhhhh.....eeeeee......hhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ppj N   2 ATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFW 443
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441

Chain O from PDB  Type:PROTEIN  Length:424
 aligned with QCR2_BOVIN | P23004 from UniProtKB/Swiss-Prot  Length:453

    Alignment length:428
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445        
           QCR2_BOVIN    26 EAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYHGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL 453
               SCOP domains -----d1ppjo1 O:17-235 Cytochrome bc1 core subunit 2                                                                                                                                                                             d1ppjo2 O:236-439 Cytochrome bc1 core subunit 2                                                                                                                                                              SCOP domains
               CATH domains -----1ppjO01 O:17-227 Cytochrome Bc1 Complex; Chain A, domain 1                                                                                                                                                         -----------1ppjO02 O:239-439 Cytochrome Bc1 Complex; Chain A, domain 1                                                                                                                                               CATH domains
           Pfam domains (1) ----------------------Peptidase_M16-1ppjO01 O:34-180                                                                                                                     ----Peptidase_M16_C-1ppjO03 O:185-364                                                                                                                                                   --------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----------------------Peptidase_M16-1ppjO02 O:34-180                                                                                                                     ----Peptidase_M16_C-1ppjO04 O:185-364                                                                                                                                                   --------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author .----........eeee.....eeeee.....eeeeeeee..hhhhh.....hhhhhhhhh........hhhhhhhhhhhh..eeeeee....eeeeeeee..hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhhh....hhhhh...hhhhhhhhhhhhhhhh.eeeeee..hhhhhhhhhhhhh.................eeeeee....eeeeeeeee.....hhhhhhhhhhhhhhh............hhhhhhhhhhh...eeeeeeeee....eeeeeeeeee..hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh....hhhhhhhhhhh.hhhhhhhhhhhhhhh.eeeeeee......hhhhh Sec.struct. author
                 SAPs(SNPs) ---------------R---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------INSULINASE  PDB: O:54-77-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 5 (1) Exon 5.2      Exon 5.3  PDB: O:26-75 UniProt: 40-89             Exon 5.4  PDB: O:76-97------------------Exon 5.6  PDB: O:116-158 UniProt: 130-172  --------------------------------Exon 5.8            ---------------------------------Exon 5.10  PDB: O:244-310 UniProt: 258-324                         Exon 5.11  PDB: O:311-337  Exon 5.12  PDB: O:338-363 ---------------------------------------------------Exon 5.14  PDB: O:415-439 Transcript 5 (1)
           Transcript 5 (2) -------------------------------------------------------------------------------------Exon 5.5            -----------------------------------------Exon 5.7  PDB: O:158-190         -------------------Exon 5.9  PDB: O:210-244           ----------------------------------------------------------------------------------------------------------------------Exon 5.13  PDB: O:363-414 UniProt: 377-428          ------------------------- Transcript 5 (2)
                 1ppj O  12 E----VPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYHGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL 439
                            |    |  21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431        
                           12   17

Chain P from PDB  Type:PROTEIN  Length:365
 aligned with CYB_BOVIN | P00157 from UniProtKB/Swiss-Prot  Length:379

    Alignment length:365
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374     
            CYB_BOVIN    15 NNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW 379
               SCOP domains d1ppjp2 P:15-260 Mitochondrial cytochrome b subunit, N-terminal domain                                                                                                                                                                                d1ppjp1 P:261-379 Mitochondrial cytochrome b subunit, C-terminal domain                                                 SCOP domains
               CATH domains 1ppjP00 P:15-379 Cytochrome Bc1 Complex; Chain C                                                                                                                                                                                                                                                                                                                              CATH domains
           Pfam domains (1) -------------------------------------------------------------------------Cytochrom_B_N_2-1ppjP01 P:88-253                                                                                                                                      ----Cytochrom_B_C-1ppjP03 P:258-359                                                                       -------------------- Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------Cytochrom_B_N_2-1ppjP02 P:88-253                                                                                                                                      ----Cytochrom_B_C-1ppjP04 P:258-359                                                                       -------------------- Pfam domains (2)
         Sec.struct. author .......eee...hhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............eeehhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh.............hhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhh.........hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CYTB_CTER  PDB: P:210-379 UniProt: 210-379                                                                                                                                 PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ppj P  15 NNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW 379
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374

Chain Q from PDB  Type:PROTEIN  Length:241
 aligned with CY1_BOVIN | P00125 from UniProtKB/Swiss-Prot  Length:325

    Alignment length:241
                                    94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324 
            CY1_BOVIN    85 SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK 325
               SCOP domains d1ppjq1 Q:1-195 Cytochrome bc1 domain                                                                                                                                                              d1ppjq2 Q:196-241                              SCOP domains
               CATH domains 1ppjQ02 Q:1-196 Cytochrome c                                                                                                                                                                        1ppjQ01 Q:197-241                             CATH domains
           Pfam domains (1) -----------Cytochrom_C1-1ppjQ01 Q:12-230                                                                                                                                                                                              ----------- Pfam domains (1)
           Pfam domains (2) -----------Cytochrom_C1-1ppjQ02 Q:12-230                                                                                                                                                                                              ----------- Pfam domains (2)
         Sec.struct. author .....................hhhhhhhhhhhhhhhhhhh......hhhhhh....hhhhhhhhhhh.eeee........eeee............hhhhhhhh.................hhhhhhhhhhh...............ee.......ee...................hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------CYTC  PDB: Q:24-125 UniProt: 108-209                                                                  -------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 4 (1) Exon 4.2  PDB: Q:1-26     ------------------------------------------Exon 4.4  PDB: Q:69-121 UniProt: 153-205             -----------------------------------------------------Exon 4.6  PDB: Q:175-208          Exon 4.7  PDB: Q:209-241          Transcript 4 (1)
           Transcript 4 (2) -------------------------Exon 4.3  PDB: Q:26-68 UniProt: 110-152    ----------------------------------------------------Exon 4.5  PDB: Q:121-175 UniProt: 205-259              ------------------------------------------------------------------ Transcript 4 (2)
                 1ppj Q   1 SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK 241
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain R from PDB  Type:PROTEIN  Length:196
 aligned with UCRI_BOVIN | P13272 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:196
                                    88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268      
           UCRI_BOVIN    79 SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG 274
               SCOP domains d1ppjr2 R:1-69                                                       d1ppjr1 R:70-196 ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain                                  SCOP domains
               CATH domains --1ppjR01 R:3-66  [code=1.20.5.270, no name defined]              1ppjR02 R:67-196 'Rieske'-like iron-sulphur domains                                                                                CATH domains
           Pfam domains (1) UCR_TM-1ppjR03 R:1-67                                              ---------Rieske-1ppjR01 R:77-188                                                                                         -------- Pfam domains (1)
           Pfam domains (2) UCR_TM-1ppjR04 R:1-67                                              ---------Rieske-1ppjR02 R:77-188                                                                                         -------- Pfam domains (2)
         Sec.struct. author hhhhh.........hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eeee.hhh....eeeeee..eeeeeee.hhhhhhhhhhhhhhhh....hhhhh.....eeeee..........ee.....eeeee....eeee....eee...........eee....eeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------RIESKE  PDB: R:109-194 UniProt: 187-272                                               -- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ppj R   1 SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG 196
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190

Chain S from PDB  Type:PROTEIN  Length:99
 aligned with QCR7_BOVIN | P00129 from UniProtKB/Swiss-Prot  Length:111

    Alignment length:99
                                    22        32        42        52        62        72        82        92       102         
           QCR7_BOVIN    13 WLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYNDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWAKK 111
               SCOP domains d1ppjs_ S: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)              SCOP domains
               CATH domains 1ppjS00 S:12-110 Cytochrome Bc1 Complex; Chain F                                                    CATH domains
           Pfam domains (1) UCR_14kD-1ppjS01 S:12-106                                                                      ---- Pfam domains (1)
           Pfam domains (2) UCR_14kD-1ppjS02 S:12-106                                                                      ---- Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhhhhhhhh.hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhh.hhhhh...hhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.2           -------------------------------------------------------Exon 2.4  PDB: S:86-110   Transcript 2 (1)
           Transcript 2 (2) ------------------Exon 2.3  PDB: S:30-85 UniProt: 31-86                   ------------------------- Transcript 2 (2)
                 1ppj S  12 WLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWAKK 110
                                    21        31        41        51        61        71        81        91       101

Chain T from PDB  Type:PROTEIN  Length:76
 aligned with QCR8_BOVIN | P13271 from UniProtKB/Swiss-Prot  Length:82

    Alignment length:76
                                    11        21        31        41        51        61        71      
           QCR8_BOVIN     2 GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAA  77
               SCOP domains d1ppjt_ T:                                                                   SCOP domains
               CATH domains 1ppjT00 T:1-76  [code=1.20.5.210, no name defined]                           CATH domains
           Pfam domains (1) UcrQ-1ppjT01 T:1-76                                                          Pfam domains (1)
           Pfam domains (2) UcrQ-1ppjT02 T:1-76                                                          Pfam domains (2)
         Sec.struct. author ..........eeeeeeee.hhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------- PROSITE
           Transcript 6 (1) Exon 6.2b  PDB: T:1-51 UniProt: 1-52 [INCOMPLETE]  ------------------------- Transcript 6 (1)
           Transcript 6 (2) --------------------------------------------------Exon 6.3a  PDB: T:51-76    Transcript 6 (2)
                 1ppj T   1 GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAA  76
                                    10        20        30        40        50        60        70

Chain U from PDB  Type:PROTEIN  Length:66
 aligned with QCR6_BOVIN | P00126 from UniProtKB/Swiss-Prot  Length:91

    Alignment length:66
                                    35        45        55        65        75        85      
           QCR6_BOVIN    26 LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK  91
               SCOP domains d1ppju_ U:                                                         SCOP domains
               CATH domains 1ppjU00 U:13-78  [code=1.10.287.20, no name defined]               CATH domains
           Pfam domains (1) -UCR_hinge-1ppjU01 U:14-78                                         Pfam domains (1)
           Pfam domains (2) -UCR_hinge-1ppjU02 U:14-78                                         Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
               Transcript 3 3.Exon 3.3  PDB: U:15-68 UniProt: 28-81                 Exon 3.4   Transcript 3
                 1ppj U  13 LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK  78
                                    22        32        42        52        62        72

Chain V from PDB  Type:PROTEIN  Length:43
 aligned with UCRI_BOVIN | P13272 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:47
                                    41        51        61        71       
           UCRI_BOVIN    32 AAVPATSESPVLDLKRSVLCRESLRGQAAGRPLVASVSLNVPASVRY  78
               SCOP domains d1ppjv_ V:                                      SCOP domains
               CATH domains 1ppjV00 V:32    -78 Cytochrome Bc1 Complex; Cha CATH domains
           Pfam domains (1) Ubiq-Cytc-re    d_N-1ppjV0--------------------- Pfam domains (1)
           Pfam domains (2) Ubiq-Cytc-re    d_N-1ppjV0--------------------- Pfam domains (2)
         Sec.struct. author ............----...hhhhhh.........eeee.....ee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------- Transcript
                 1ppj V  32 AAVPATSESPVL----SVLCRESLRGQAAGRPLVASVSLNVPASVRY  78
                                    41 |    | 51        61        71       
                                      43   48

Chain W from PDB  Type:PROTEIN  Length:62
 aligned with QCR9_BOVIN | P00130 from UniProtKB/Swiss-Prot  Length:64

    Alignment length:62
                                    11        21        31        41        51        61  
           QCR9_BOVIN     2 VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK  63
               SCOP domains d1ppjw_ W:                                                     SCOP domains
               CATH domains 1ppjW00 W:1-62  [code=1.20.5.260, no name defined]             CATH domains
           Pfam domains (1) -----UCR_UQCRX_QCR9-1ppjW01 W:6-60                          -- Pfam domains (1)
           Pfam domains (2) -----UCR_UQCRX_QCR9-1ppjW02 W:6-60                          -- Pfam domains (2)
         Sec.struct. author ...hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: W:1-49 UniProt: 1-50 [INCOMPLETE] Exon 1.2      Transcript 1
                 1ppj W   1 VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK  62
                                    10        20        30        40        50        60

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,N (QCR1_BOVIN | P31800)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004222	metalloendopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0009060	aerobic respiration	The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which requires oxygen as the terminal electron acceptor.
	GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	The transfer of electrons from ubiquinol to cytochrome c that occurs during oxidative phosphorylation, mediated by the multisubunit enzyme known as complex III.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0016485	protein processing	Any protein maturation process achieved by the cleavage of a peptide bond or bonds within a protein. Protein maturation is the process leading to the attainment of the full functional capacity of a protein.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005750	mitochondrial respiratory chain complex III	A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains about 10 polypeptide subunits including four redox centers: cytochrome b/b6, cytochrome c1 and an 2Fe-2S cluster. Catalyzes the oxidation of ubiquinol by oxidized cytochrome c1.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Chain B,O (QCR2_BOVIN | P23004)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004222	metalloendopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0009060	aerobic respiration	The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which requires oxygen as the terminal electron acceptor.
	GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	The transfer of electrons from ubiquinol to cytochrome c that occurs during oxidative phosphorylation, mediated by the multisubunit enzyme known as complex III.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0016485	protein processing	Any protein maturation process achieved by the cleavage of a peptide bond or bonds within a protein. Protein maturation is the process leading to the attainment of the full functional capacity of a protein.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005750	mitochondrial respiratory chain complex III	A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains about 10 polypeptide subunits including four redox centers: cytochrome b/b6, cytochrome c1 and an 2Fe-2S cluster. Catalyzes the oxidation of ubiquinol by oxidized cytochrome c1.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Chain C,P (CYB_BOVIN | P00157)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0008121	ubiquinol-cytochrome-c reductase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: CoQH2 + 2 ferricytochrome c = CoQ + 2 ferrocytochrome c + 2 H+.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	The transfer of electrons from ubiquinol to cytochrome c that occurs during oxidative phosphorylation, mediated by the multisubunit enzyme known as complex III.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0022904	respiratory electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.
	GO:0045275	respiratory chain complex III	A protein complex that transfers electrons from ubiquinol to cytochrome c and translocates two protons across a membrane. The complex contains a core structure of three catalytic subunits: cytochrome b, the Rieske iron sulfur protein (ISP), and cytochrome c1, which are arranged in an integral membrane-bound dimeric complex; additional subunits are present, and vary among different species.

Chain D,Q (CY1_BOVIN | P00125)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Chain E,I,R,V (UCRI_BOVIN | P13272)

molecular function
	GO:0051537	2 iron, 2 sulfur cluster binding	Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016679	oxidoreductase activity, acting on diphenols and related substances as donors	Catalysis of an oxidation-reduction (redox) reaction in which a diphenol or related substance acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
	GO:0008121	ubiquinol-cytochrome-c reductase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: CoQH2 + 2 ferricytochrome c = CoQ + 2 ferrocytochrome c + 2 H+.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Chain F,S (QCR7_BOVIN | P00129)

molecular function
	GO:0008121	ubiquinol-cytochrome-c reductase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: CoQH2 + 2 ferricytochrome c = CoQ + 2 ferrocytochrome c + 2 H+.
biological process
	GO:0009060	aerobic respiration	The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which requires oxygen as the terminal electron acceptor.
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	The transfer of electrons from ubiquinol to cytochrome c that occurs during oxidative phosphorylation, mediated by the multisubunit enzyme known as complex III.
	GO:0034551	mitochondrial respiratory chain complex III assembly	The aggregation, arrangement and bonding together of a set of components to form the cytochrome bc(1) complex (also known as ubiquinol-cytochrome c reductase), in the mitochondrial inner membrane.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005750	mitochondrial respiratory chain complex III	A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains about 10 polypeptide subunits including four redox centers: cytochrome b/b6, cytochrome c1 and an 2Fe-2S cluster. Catalyzes the oxidation of ubiquinol by oxidized cytochrome c1.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Chain G,T (QCR8_BOVIN | P13271)

molecular function
	GO:0008121	ubiquinol-cytochrome-c reductase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: CoQH2 + 2 ferricytochrome c = CoQ + 2 ferrocytochrome c + 2 H+.
biological process
	GO:0021680	cerebellar Purkinje cell layer development	The process whose specific outcome is the progression of the cerebellar Purkinje cell layer over time, from its formation to the mature structure. The Purkinje cell layer lies just underneath the molecular layer of the cerebellar cortex. It contains the neuronal cell bodies of the Purkinje cells that are arranged side by side in a single layer. Candelabrum interneurons are vertically oriented between the Purkinje cells. Purkinje neurons are inhibitory and provide the output of the cerebellar cortex through axons that project into the white matter. Extensive dendritic trees from the Purkinje cells extend upward in a single plane into the molecular layer where they synapse with parallel fibers of granule cells.
	GO:0021766	hippocampus development	The progression of the hippocampus over time from its initial formation until its mature state.
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0021854	hypothalamus development	The progression of the hypothalamus region of the forebrain, from its initial formation to its mature state.
	GO:0030901	midbrain development	The process whose specific outcome is the progression of the midbrain over time, from its formation to the mature structure. The midbrain is the middle division of the three primary divisions of the developing chordate brain or the corresponding part of the adult brain (in vertebrates, includes a ventral part containing the cerebral peduncles and a dorsal tectum containing the corpora quadrigemina and that surrounds the aqueduct of Sylvius connecting the third and fourth ventricles).
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0021548	pons development	The process whose specific outcome is the progression of the pons over time, from its formation to the mature structure. The pons lies above the medulla and next to the cerebellum. The pons conveys information about movement from the cerebral hemisphere to the cerebellum.
	GO:0021860	pyramidal neuron development	The progression of a pyramidal neuron from its initial formation to its mature state.
	GO:0021539	subthalamus development	The process whose specific outcome is the progression of the subthalamus over time, from its formation to the mature structure. The subthalamus is the anterior part of the diencephalon that lies between the thalamus, hypothalamus, and tegmentum of the mesencephalon, including subthalamic nucleus, zona incerta, the fields of Forel, and the nucleus of ansa lenticularis.
	GO:0021794	thalamus development	The process in which the thalamus changes over time, from its initial formation to its mature state.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Chain H,U (QCR6_BOVIN | P00126)

molecular function
	GO:0008121	ubiquinol-cytochrome-c reductase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: CoQH2 + 2 ferricytochrome c = CoQ + 2 ferrocytochrome c + 2 H+.
biological process
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	The transfer of electrons from ubiquinol to cytochrome c that occurs during oxidative phosphorylation, mediated by the multisubunit enzyme known as complex III.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Chain J,W (QCR9_BOVIN | P00130)

molecular function
	GO:0008121	ubiquinol-cytochrome-c reductase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: CoQH2 + 2 ferricytochrome c = CoQ + 2 ferrocytochrome c + 2 H+.
biological process
	GO:0009060	aerobic respiration	The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which requires oxygen as the terminal electron acceptor.
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	The transfer of electrons from ubiquinol to cytochrome c that occurs during oxidative phosphorylation, mediated by the multisubunit enzyme known as complex III.
	GO:0034551	mitochondrial respiratory chain complex III assembly	The aggregation, arrangement and bonding together of a set of components to form the cytochrome bc(1) complex (also known as ubiquinol-cytochrome c reductase), in the mitochondrial inner membrane.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005750	mitochondrial respiratory chain complex III	A protein complex located in the mitochondrial inner membrane that forms part of the mitochondrial respiratory chain. Contains about 10 polypeptide subunits including four redox centers: cytochrome b/b6, cytochrome c1 and an 2Fe-2S cluster. Catalyzes the oxidation of ubiquinol by oxidized cytochrome c1.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (11, 45)

Sites (45, 45)

SS Bonds (6, 6)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 4)

PROSITE Motifs (4, 8)

Exons (29, 58)

Sequences/Alignments

Classification and Annotation

SCOP Domains (13, 30)

CATH Domains (11, 27)

Pfam Domains (12, 28)

Gene Ontology (38, 113)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File