|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 3)
|
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 1PMP) |
(no "Cis Peptide Bond" information available for 1PMP) |
(no "SAP(SNP)/Variant" information available for 1PMP) |
Asymmetric Unit (1, 3)
|
Asymmetric Unit (4, 12)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:131 aligned with MYP2_BOVIN | P02690 from UniProtKB/Swiss-Prot Length:132 Alignment length:131 11 21 31 41 51 61 71 81 91 101 111 121 131 MYP2_BOVIN 2 SNKFLGTWKLVSSENFDEYMKALGVGLATRKLGNLAKPRVIISKKGDIITIRTESPFKNTEISFKLGQEFEETTADNRKTKSTVTLARGSLNQVQKWDGNETTIKRKLVDGKMVVECKMKDVVCTRIYEKV 132 SCOP domains d1pmpa_ A: P2 myelin protein SCOP domains CATH domains 1pmpA00 A:1-131 [code=2.40.128.20, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----FABP PDB: A:6-23 ------------------------------------------------------------------------------------------------------------ PROSITE Transcript 1 (1) Exon 1.1 PDB: A:1-26 ---------------------------------------------------------Exon 1.3 PDB: A:84-117 Exon 1.4 Transcript 1 (1) Transcript 1 (2) -------------------------Exon 1.2 PDB: A:26-83 UniProt: 27-84 ------------------------------------------------ Transcript 1 (2) 1pmp A 1 SNKFLGTWKLVSSENFDEYMKALGVGLATRKLGNLAKPRVIISKKGDIITIRTESPFKNTEISFKLGQEFEETTADNRKTKSTVTLARGSLNQVQKWNGNETTIKRKLVDGKMVVECKMKDVVCTRIYEKV 131 10 20 30 40 50 60 70 80 90 100 110 120 130 Chain B from PDB Type:PROTEIN Length:131 aligned with MYP2_BOVIN | P02690 from UniProtKB/Swiss-Prot Length:132 Alignment length:131 11 21 31 41 51 61 71 81 91 101 111 121 131 MYP2_BOVIN 2 SNKFLGTWKLVSSENFDEYMKALGVGLATRKLGNLAKPRVIISKKGDIITIRTESPFKNTEISFKLGQEFEETTADNRKTKSTVTLARGSLNQVQKWDGNETTIKRKLVDGKMVVECKMKDVVCTRIYEKV 132 SCOP domains d1pmpb_ B: P2 myelin protein SCOP domains CATH domains 1pmpB00 B:1-131 [code=2.40.128.20, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----FABP PDB: B:6-23 ------------------------------------------------------------------------------------------------------------ PROSITE Transcript 1 (1) Exon 1.1 PDB: B:1-26 ---------------------------------------------------------Exon 1.3 PDB: B:84-117 Exon 1.4 Transcript 1 (1) Transcript 1 (2) -------------------------Exon 1.2 PDB: B:26-83 UniProt: 27-84 ------------------------------------------------ Transcript 1 (2) 1pmp B 1 SNKFLGTWKLVSSENFDEYMKALGVGLATRKLGNLAKPRVIISKKGDIITIRTESPFKNTEISFKLGQEFEETTADNRKTKSTVTLARGSLNQVQKWNGNETTIKRKLVDGKMVVECKMKDVVCTRIYEKV 131 10 20 30 40 50 60 70 80 90 100 110 120 130 Chain C from PDB Type:PROTEIN Length:131 aligned with MYP2_BOVIN | P02690 from UniProtKB/Swiss-Prot Length:132 Alignment length:131 11 21 31 41 51 61 71 81 91 101 111 121 131 MYP2_BOVIN 2 SNKFLGTWKLVSSENFDEYMKALGVGLATRKLGNLAKPRVIISKKGDIITIRTESPFKNTEISFKLGQEFEETTADNRKTKSTVTLARGSLNQVQKWDGNETTIKRKLVDGKMVVECKMKDVVCTRIYEKV 132 SCOP domains d1pmpc_ C: P2 myelin protein SCOP domains CATH domains 1pmpC00 C:1-131 [code=2.40.128.20, no name defined] CATH domains Pfam domains (1) ----Lipocalin-1pmpC01 C:5-131 Pfam domains (1) Pfam domains (2) ----Lipocalin-1pmpC02 C:5-131 Pfam domains (2) Pfam domains (3) ----Lipocalin-1pmpC03 C:5-131 Pfam domains (3) SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----FABP PDB: C:6-23 ------------------------------------------------------------------------------------------------------------ PROSITE Transcript 1 (1) Exon 1.1 PDB: C:1-26 ---------------------------------------------------------Exon 1.3 PDB: C:84-117 Exon 1.4 Transcript 1 (1) Transcript 1 (2) -------------------------Exon 1.2 PDB: C:26-83 UniProt: 27-84 ------------------------------------------------ Transcript 1 (2) 1pmp C 1 SNKFLGTWKLVSSENFDEYMKALGVGLATRKLGNLAKPRVIISKKGDIITIRTESPFKNTEISFKLGQEFEETTADNRKTKSTVTLARGSLNQVQKWNGNETTIKRKLVDGKMVVECKMKDVVCTRIYEKV 131 10 20 30 40 50 60 70 80 90 100 110 120 130
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C (MYP2_BOVIN | P02690)
|
|
|
|
|
|
|