1PL6 - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   HUMAN SDH/NADH/INHIBITOR COMPLEX

Authors :   T. A. Pauly, J. L. Ekstrom, D. A. Beebe, B. Chrunyk, D. Cunningham, M. Gri A. Kamath, S. E. Lee, R. Madura, D. Mcguire, T. Subashi, D. Wasilko, P. W B. L. Mylari, P. J. Oates, P. D. Adams, V. L. Rath

Date :   07 Jun 03 (Deposition) - 17 Feb 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (2x)
Biol. Unit 2: C,D  (1x)
Biol. Unit 3: A,B,C,D  (1x)

Keywords :   Sorbitol Dehydrogenase, Cp-166, 572, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. A. Pauly, J. L. Ekstrom, D. A. Beebe, B. Chrunyk, D. Cunningham, M. Griffor, A. Kamath, S. E. Lee, R. Madura, D. Mcguire, T. Subashi, D. Wasilko, P. Watts, B. L. Mylari, P. J. Oates, P. D. Adams, V. L. Rath
X-Ray Crystallographic And Kinetic Studies Of Human Sorbito Dehydrogenase.
Structure V. 11 1071 2003
PubMed-ID: 12962626 | Reference-DOI: 10.1016/S0969-2126(03)00167-9

Molecule 1 - SORBITOL DEHYDROGENASE
	Chains	:	A, B, C, D
	EC Number	:	1.1.1.14
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Strain	:	BL21 DE3
	Expression System Taxid	:	469008
	Expression System Vector	:	PET23A
	Expression System Vector Type	:	PLASMID
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	L-IDITOL 2-DEHYDROGENASE

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (2x)	:	A	B
Biological Unit 2 (1x)	:			C	D
Biological Unit 3 (1x)	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (4, 44)

No.	Name	Count	Type	Full Name
1	572	4	Ligand/Ion	4-[2-(HYDROXYMETHYL)PYRIMIDIN-4-YL]-N,N-DIMETHYLPIPERAZINE-1-SULFONAMIDE
2	MSE	32	Mod. Amino Acid	SELENOMETHIONINE
3	NAD	4	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE
4	ZN	4	Ligand/Ion	ZINC ION

Biological Unit 1 (3, 40)

No.	Name	Count	Type	Full Name
1	572	4	Ligand/Ion	4-[2-(HYDROXYMETHYL)PYRIMIDIN-4-YL]-N,N-DIMETHYLPIPERAZINE-1-SULFONAMIDE
2	MSE	32	Mod. Amino Acid	SELENOMETHIONINE
3	NAD	4	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE
4	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (3, 20)

No.	Name	Count	Type	Full Name
1	572	2	Ligand/Ion	4-[2-(HYDROXYMETHYL)PYRIMIDIN-4-YL]-N,N-DIMETHYLPIPERAZINE-1-SULFONAMIDE
2	MSE	16	Mod. Amino Acid	SELENOMETHIONINE
3	NAD	2	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE
4	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 3 (3, 40)

No.	Name	Count	Type	Full Name
1	572	4	Ligand/Ion	4-[2-(HYDROXYMETHYL)PYRIMIDIN-4-YL]-N,N-DIMETHYLPIPERAZINE-1-SULFONAMIDE
2	MSE	32	Mod. Amino Acid	SELENOMETHIONINE
3	NAD	4	Ligand/Ion	NICOTINAMIDE-ADENINE-DINUCLEOTIDE
4	ZN	-1	Ligand/Ion	ZINC ION

Asymmetric Unit (12, 12)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	CYS A:44 , SER A:46 , HIS A:69 , 572 A:405 , HOH A:1064	BINDING SITE FOR RESIDUE ZN A 402
02	AC2	SOFTWARE	CYS B:44 , HIS B:69 , 572 B:407 , HOH B:1543	BINDING SITE FOR RESIDUE ZN B 402
03	AC3	SOFTWARE	CYS C:44 , HIS C:69 , 572 C:409 , HOH C:1055	BINDING SITE FOR RESIDUE ZN C 402
04	AC4	SOFTWARE	CYS D:44 , SER D:46 , HIS D:69 , 572 D:411 , HOH D:1042	BINDING SITE FOR RESIDUE ZN D 402
05	AC5	SOFTWARE	GLY A:181 , PRO A:182 , ILE A:183 , ASP A:203 , ARG A:208 , CYS A:249 , THR A:250 , VAL A:272 , GLY A:273 , LEU A:274 , VAL A:296 , PHE A:297 , ARG A:298 , 572 A:405 , HOH A:1069 , HOH A:1330 , HOH A:1363 , HOH A:1431 , HOH A:1501 , HOH A:1514 , HOH A:1526 , HOH A:1579 , HOH A:1764 , HOH A:2038 , HOH A:2205	BINDING SITE FOR RESIDUE NAD A 404
06	AC6	SOFTWARE	CYS A:44 , SER A:46 , TYR A:50 , ILE A:56 , PHE A:59 , HIS A:69 , THR A:121 , GLU A:155 , LEU A:274 , PHE A:297 , ZN A:402 , NAD A:404 , HOH A:1064 , HOH A:1200 , HOH A:1645 , HOH A:2007	BINDING SITE FOR RESIDUE 572 A 405
07	AC7	SOFTWARE	GLY B:181 , PRO B:182 , ILE B:183 , ASP B:203 , LEU B:204 , ARG B:208 , CYS B:249 , THR B:250 , VAL B:272 , GLY B:273 , LEU B:274 , VAL B:296 , PHE B:297 , ARG B:298 , 572 B:407 , HOH B:1034 , HOH B:1236 , HOH B:1344 , HOH B:1358 , HOH B:1458 , HOH B:1638 , HOH B:1666 , HOH B:1780 , HOH B:1811 , HOH B:2061 , HOH B:2117	BINDING SITE FOR RESIDUE NAD B 406
08	AC8	SOFTWARE	CYS B:44 , SER B:46 , TYR B:50 , ILE B:56 , PHE B:59 , HIS B:69 , THR B:121 , GLU B:155 , LEU B:274 , PHE B:297 , ZN B:402 , NAD B:406 , HOH B:1490 , HOH B:1543 , HOH B:2005	BINDING SITE FOR RESIDUE 572 B 407
09	AC9	SOFTWARE	GLY C:181 , PRO C:182 , ILE C:183 , ASP C:203 , LEU C:204 , ARG C:208 , CYS C:249 , THR C:250 , VAL C:272 , GLY C:273 , LEU C:274 , VAL C:296 , PHE C:297 , ARG C:298 , 572 C:409 , HOH C:1174 , HOH C:1270 , HOH C:1357 , HOH C:1420 , HOH C:1468 , HOH C:1469 , HOH C:1681 , HOH C:2073 , HOH C:2112 , HOH C:2187	BINDING SITE FOR RESIDUE NAD C 408
10	BC1	SOFTWARE	CYS C:44 , SER C:46 , TYR C:50 , ILE C:56 , PHE C:59 , HIS C:69 , THR C:121 , GLU C:155 , LEU C:274 , PHE C:297 , ZN C:402 , NAD C:408 , HOH C:1055 , HOH C:1796	BINDING SITE FOR RESIDUE 572 C 409
11	BC2	SOFTWARE	GLY D:181 , PRO D:182 , ILE D:183 , ASP D:203 , LEU D:204 , ARG D:208 , CYS D:249 , THR D:250 , VAL D:272 , GLY D:273 , LEU D:274 , VAL D:296 , PHE D:297 , ARG D:298 , 572 D:411 , HOH D:1079 , HOH D:1413 , HOH D:1447 , HOH D:1456 , HOH D:1464 , HOH D:1484 , HOH D:1537 , HOH D:1632 , HOH D:1737 , HOH D:1855 , HOH D:1940 , HOH D:2208	BINDING SITE FOR RESIDUE NAD D 410
12	BC3	SOFTWARE	CYS D:44 , SER D:46 , TYR D:50 , ILE D:56 , PHE D:59 , HIS D:69 , THR D:121 , GLU D:155 , LEU D:274 , PHE D:297 , ZN D:402 , NAD D:410 , HOH D:1042 , HOH D:1507 , HOH D:1976 , HOH D:2029	BINDING SITE FOR RESIDUE 572 D 411

(no "SS Bond" information available for 1PL6)

Asymmetric Unit

No.	Residues
1	Pro A:122	-	Pro A:123
2	Pro B:122	-	Pro B:123
3	Pro C:122	-	Pro C:123
4	Pro D:122	-	Pro D:123

Asymmetric Unit (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_000430	Q	239	L	DHSO_HUMAN	Polymorphism	55739437	A/B/C/D	Q	238	L
2	UniProt	VAR_060351	N	269	T	DHSO_HUMAN	Polymorphism	2229659	A/B/C/D	T	268	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_000430	Q	239	L	DHSO_HUMAN	Polymorphism	55739437	A/B	Q	238	L
2	UniProt	VAR_060351	N	269	T	DHSO_HUMAN	Polymorphism	2229659	A/B	T	268	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_000430	Q	239	L	DHSO_HUMAN	Polymorphism	55739437	C/D	Q	238	L
2	UniProt	VAR_060351	N	269	T	DHSO_HUMAN	Polymorphism	2229659	C/D	T	268	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_000430	Q	239	L	DHSO_HUMAN	Polymorphism	55739437	A/B/C/D	Q	238	L
2	UniProt	VAR_060351	N	269	T	DHSO_HUMAN	Polymorphism	2229659	A/B/C/D	T	268	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADH_ZINC	PS00059	Zinc-containing alcohol dehydrogenases signature.	DHSO_HUMAN	69-83	4	A:68-82 B:68-82 C:68-82 D:68-82

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADH_ZINC	PS00059	Zinc-containing alcohol dehydrogenases signature.	DHSO_HUMAN	69-83	4	A:68-82 B:68-82 - -

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADH_ZINC	PS00059	Zinc-containing alcohol dehydrogenases signature.	DHSO_HUMAN	69-83	2	- - C:68-82 D:68-82

Biological Unit 3 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADH_ZINC	PS00059	Zinc-containing alcohol dehydrogenases signature.	DHSO_HUMAN	69-83	4	A:68-82 B:68-82 C:68-82 D:68-82

Asymmetric Unit (9, 36)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000267814	1	ENSE00001217432	chr15:45315305-45315547	243	DHSO_HUMAN	1-22	22	4	A:1-21 B:1-21 C:1-21 D:1-21	21 21 21 21
1.2	ENST00000267814	2	ENSE00001121784	chr15:45332606-45332639	34	DHSO_HUMAN	23-34	12	4	A:22-33 B:22-33 C:22-33 D:22-33	12 12 12 12
1.3	ENST00000267814	3	ENSE00001121776	chr15:45335455-45335619	165	DHSO_HUMAN	34-89	56	4	A:33-88 B:33-88 C:33-88 D:33-88	56 56 56 56
1.4	ENST00000267814	4	ENSE00001121766	chr15:45353265-45353424	160	DHSO_HUMAN	89-142	54	4	A:88-141 B:88-141 C:88-141 D:88-141	54 54 54 54
1.5	ENST00000267814	5	ENSE00000942000	chr15:45357469-45357587	119	DHSO_HUMAN	142-182	41	4	A:141-181 B:141-181 C:141-181 D:141-181	41 41 41 41
1.6	ENST00000267814	6	ENSE00000942001	chr15:45360379-45360444	66	DHSO_HUMAN	182-204	23	4	A:181-203 B:181-203 C:181-203 D:181-203	23 23 23 23
1.7	ENST00000267814	7	ENSE00000942002	chr15:45361075-45361250	176	DHSO_HUMAN	204-262	59	4	A:203-261 B:203-261 C:203-261 D:203-261	59 59 59 59
1.8	ENST00000267814	8	ENSE00001121738	chr15:45364515-45364636	122	DHSO_HUMAN	263-303	41	4	A:262-302 B:262-302 C:262-302 D:262-302	41 41 41 41
1.9	ENST00000267814	9	ENSE00001140428	chr15:45365563-45367043	1481	DHSO_HUMAN	303-357	55	4	A:302-356 B:302-356 C:302-356 D:302-356	55 55 55 55

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:356
 aligned with DHSO_HUMAN | Q00796 from UniProtKB/Swiss-Prot  Length:357

    Alignment length:356
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351      
           DHSO_HUMAN     2 AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP 357
               SCOP domains d1pl6a1 A:1-145,A:317-356 Ketose reductase (sorbitol dehydrogenase)                                                                              d1pl6a2 A:146-316 Ketose reductase (sorbitol dehydrogenase)                                                                                                                d1pl6a1 A:1-145,A:317-356                SCOP domains
               CATH domains 1pl6A01 A:1-158,A:298-356 Medium-chain alcohol dehydrogenases, catalytic domain                                                                               1pl6A02 A:159-297 NAD(P)-binding Rossmann-like Domain                                                                                      1pl6A01 A:1-158,A:298-356                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeee..eeeeee.........eeeeeeeeee.hhhhhhhhhhhee..ee....ee...eeeeeeeee...........eeee..ee....hhhhhh.hhhhh...ee............eeeee...eee.....hhhhhhhhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhh...eeeeee.hhhhhhhhhhh...eeee....hhhhhhhhhhhhhh....eeee...hhhhhhhhhhhh....eeee..........hhhhhhh...eeee......hhhhhhhhhhh....hhh.eeeeee..hhhhhhhhhhh....eeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L-----------------------------T---------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------ADH_ZINC       ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:1-21Exon 1.2    ------------------------------------------------------Exon 1.4  PDB: A:88-141 UniProt: 89-142               ---------------------------------------Exon 1.6  PDB: A:181-20----------------------------------------------------------Exon 1.8  PDB: A:262-302 UniProt: 263-303------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) --------------------------------Exon 1.3  PDB: A:33-88 UniProt: 34-89                   ----------------------------------------------------Exon 1.5  PDB: A:141-181 UniProt: 142-182---------------------Exon 1.7  PDB: A:203-261 UniProt: 204-262                  ----------------------------------------Exon 1.9  PDB: A:302-356 UniProt: 303-357               Transcript 1 (2)
                 1pl6 A   1 AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRmHSVGICGSDVHYWEYGRIGNFIVKKPmVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKmGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGmVTLLVAKAmGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEmTTVPLLHAAIREVDIKGVFRYCNTWPVAISmLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKImLKCDPSDQNP 356
                                    10        20        30       |40        50        60    |   70        80        90       100      |110       120       130       140       150       160       170       180    |  190   |   200       210       220       230       240       250       260       270       280       290       300       310       320       330       340     | 350      
                                                                38-MSE                     65-MSE                                   107-MSE                                                                       185-MSE  194-MSE                                                                             278-MSE                        309-MSE                              346-MSE

Chain B from PDB  Type:PROTEIN  Length:356
 aligned with DHSO_HUMAN | Q00796 from UniProtKB/Swiss-Prot  Length:357

    Alignment length:356
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351      
           DHSO_HUMAN     2 AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP 357
               SCOP domains d1pl6b1 B:1-145,B:317-356 Ketose reductase (sorbitol dehydrogenase)                                                                              d1pl6b2 B:146-316 Ketose reductase (sorbitol dehydrogenase)                                                                                                                d1pl6b1 B:1-145,B:317-356                SCOP domains
               CATH domains 1pl6B01 B:1-158,B:298-356 Medium-chain alcohol dehydrogenases, catalytic domain                                                                               1pl6B02 B:159-297 NAD(P)-binding Rossmann-like Domain                                                                                      1pl6B01 B:1-158,B:298-356                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeee..eeeeee.........eeeeeeeeee.hhhhhhhhhhhee..ee....ee...eeeeeeeee...........eeee..ee....hhhhhh.hhhhh...ee............eeeee...eee.....hhhhhhhhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhh...eeeeee.hhhhhhhhhhh...eeee....hhhhhhhhhhhhhh....eeee...hhhhhhhhhhhh....eeee..........hhhhhhh...eeee......hhhhhhhhhhh....hhh.eeeeee..hhhhhhhhhhhh...eeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L-----------------------------T---------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------ADH_ZINC       ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: B:1-21Exon 1.2    ------------------------------------------------------Exon 1.4  PDB: B:88-141 UniProt: 89-142               ---------------------------------------Exon 1.6  PDB: B:181-20----------------------------------------------------------Exon 1.8  PDB: B:262-302 UniProt: 263-303------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) --------------------------------Exon 1.3  PDB: B:33-88 UniProt: 34-89                   ----------------------------------------------------Exon 1.5  PDB: B:141-181 UniProt: 142-182---------------------Exon 1.7  PDB: B:203-261 UniProt: 204-262                  ----------------------------------------Exon 1.9  PDB: B:302-356 UniProt: 303-357               Transcript 1 (2)
                 1pl6 B   1 AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRmHSVGICGSDVHYWEYGRIGNFIVKKPmVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKmGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGmVTLLVAKAmGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEmTTVPLLHAAIREVDIKGVFRYCNTWPVAISmLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKImLKCDPSDQNP 356
                                    10        20        30       |40        50        60    |   70        80        90       100      |110       120       130       140       150       160       170       180    |  190   |   200       210       220       230       240       250       260       270       280       290       300       310       320       330       340     | 350      
                                                                38-MSE                     65-MSE                                   107-MSE                                                                       185-MSE  194-MSE                                                                             278-MSE                        309-MSE                              346-MSE

Chain C from PDB  Type:PROTEIN  Length:356
 aligned with DHSO_HUMAN | Q00796 from UniProtKB/Swiss-Prot  Length:357

    Alignment length:356
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351      
           DHSO_HUMAN     2 AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP 357
               SCOP domains d1pl6c1 C:1-145,C:317-356 Ketose reductase (sorbitol dehydrogenase)                                                                              d1pl6c2 C:146-316 Ketose reductase (sorbitol dehydrogenase)                                                                                                                d1pl6c1 C:1-145,C:317-356                SCOP domains
               CATH domains 1pl6C01 C:1-158,C:298-356 Medium-chain alcohol dehydrogenases, catalytic domain                                                                               1pl6C02 C:159-297 NAD(P)-binding Rossmann-like Domain                                                                                      1pl6C01 C:1-158,C:298-356                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeee..eeeeee.........eeeeeeeeee.hhhhhhhhhhhee..ee....ee...eeeeeeeee...........eeee..ee....hhhhhh.hhhhh...ee............eeeee...eee.....hhhhhhhhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhh...eeeeee.hhhhhhhhhhh...eeee....hhhhhhhhhhhhhh....eeee...hhhhhhhhhhhh....eeee..........hhhhhhh...eeee......hhhhhhhhhhh....hhh.eeeeee..hhhhhhhhhhhh...eeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L-----------------------------T---------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------ADH_ZINC       ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: C:1-21Exon 1.2    ------------------------------------------------------Exon 1.4  PDB: C:88-141 UniProt: 89-142               ---------------------------------------Exon 1.6  PDB: C:181-20----------------------------------------------------------Exon 1.8  PDB: C:262-302 UniProt: 263-303------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) --------------------------------Exon 1.3  PDB: C:33-88 UniProt: 34-89                   ----------------------------------------------------Exon 1.5  PDB: C:141-181 UniProt: 142-182---------------------Exon 1.7  PDB: C:203-261 UniProt: 204-262                  ----------------------------------------Exon 1.9  PDB: C:302-356 UniProt: 303-357               Transcript 1 (2)
                 1pl6 C   1 AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRmHSVGICGSDVHYWEYGRIGNFIVKKPmVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKmGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGmVTLLVAKAmGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEmTTVPLLHAAIREVDIKGVFRYCNTWPVAISmLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKImLKCDPSDQNP 356
                                    10        20        30       |40        50        60    |   70        80        90       100      |110       120       130       140       150       160       170       180    |  190   |   200       210       220       230       240       250       260       270       280       290       300       310       320       330       340     | 350      
                                                                38-MSE                     65-MSE                                   107-MSE                                                                       185-MSE  194-MSE                                                                             278-MSE                        309-MSE                              346-MSE

Chain D from PDB  Type:PROTEIN  Length:356
 aligned with DHSO_HUMAN | Q00796 from UniProtKB/Swiss-Prot  Length:357

    Alignment length:356
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351      
           DHSO_HUMAN     2 AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP 357
               SCOP domains d1pl6d1 D:1-145,D:317-356 Ketose reductase (sorbitol dehydrogenase)                                                                              d1pl6d2 D:146-316 Ketose reductase (sorbitol dehydrogenase)                                                                                                                d1pl6d1 D:1-145,D:317-356                SCOP domains
               CATH domains 1pl6D01 D:1-158,D:298-356 Medium-chain alcohol dehydrogenases, catalytic domain                                                                               1pl6D02 D:159-297 NAD(P)-binding Rossmann-like Domain                                                                                      1pl6D01 D:1-158,D:298-356                                   CATH domains
           Pfam domains (1) ------------------------------ADH_N-1pl6D01 D:31-142                                                                                          ---------------------------------------ADH_zinc_N-1pl6D05 D:182-312                                                                                                       -------------------------------------------- Pfam domains (1)
           Pfam domains (2) ------------------------------ADH_N-1pl6D02 D:31-142                                                                                          ---------------------------------------ADH_zinc_N-1pl6D06 D:182-312                                                                                                       -------------------------------------------- Pfam domains (2)
           Pfam domains (3) ------------------------------ADH_N-1pl6D03 D:31-142                                                                                          ---------------------------------------ADH_zinc_N-1pl6D07 D:182-312                                                                                                       -------------------------------------------- Pfam domains (3)
           Pfam domains (4) ------------------------------ADH_N-1pl6D04 D:31-142                                                                                          ---------------------------------------ADH_zinc_N-1pl6D08 D:182-312                                                                                                       -------------------------------------------- Pfam domains (4)
         Sec.struct. author ........eeeeeee..eeeeee.........eeeeeeeeee.hhhhhhhhhhhee..ee....ee...eeeeeeeee...........eeee..ee....hhhhhh.hhhhh...ee............eeeee...eee.....hhhhhhhhhhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhh...eeeeee.hhhhhhhhhhh...eeee....hhhhhhhhhhhhhh....eeee...hhhhhhhhhhhh....eeee..........hhhhhhh...eeee......hhhhhhhhhhh....hhh.eeeeee..hhhhhhhhhhh....eeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L-----------------------------T---------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------ADH_ZINC       ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: D:1-21Exon 1.2    ------------------------------------------------------Exon 1.4  PDB: D:88-141 UniProt: 89-142               ---------------------------------------Exon 1.6  PDB: D:181-20----------------------------------------------------------Exon 1.8  PDB: D:262-302 UniProt: 263-303------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) --------------------------------Exon 1.3  PDB: D:33-88 UniProt: 34-89                   ----------------------------------------------------Exon 1.5  PDB: D:141-181 UniProt: 142-182---------------------Exon 1.7  PDB: D:203-261 UniProt: 204-262                  ----------------------------------------Exon 1.9  PDB: D:302-356 UniProt: 303-357               Transcript 1 (2)
                 1pl6 D   1 AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRmHSVGICGSDVHYWEYGRIGNFIVKKPmVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKmGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGmVTLLVAKAmGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEmTTVPLLHAAIREVDIKGVFRYCNTWPVAISmLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKImLKCDPSDQNP 356
                                    10        20        30       |40        50        60    |   70        80        90       100      |110       120       130       140       150       160       170       180    |  190   |   200       210       220       230       240       250       260       270       280       290       300       310       320       330       340     | 350      
                                                                38-MSE                     65-MSE                                   107-MSE                                                                       185-MSE  194-MSE                                                                             278-MSE                        309-MSE                              346-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: GroES-like (132)

Superfamily: GroES-like (130)

Family: Alcohol dehydrogenase-like, N-terminal domain (114)

Protein domain: Ketose reductase (sorbitol dehydrogenase) (4)

Human (Homo sapiens) [TaxId: 9606] (3)

1a	d1pl6a1	A:1-145,A:317-356
1b	d1pl6b1	B:1-145,B:317-356
1c	d1pl6c1	C:1-145,C:317-356
1d	d1pl6d1	D:1-145,D:317-356

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: Alcohol dehydrogenase-like, C-terminal domain (115)

Protein domain: Ketose reductase (sorbitol dehydrogenase) (4)

Human (Homo sapiens) [TaxId: 9606] (3)

2a	d1pl6a2	A:146-316
2b	d1pl6b2	B:146-316
2c	d1pl6c2	C:146-316
2d	d1pl6d2	D:146-316

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Human (Homo sapiens) (188)

1a	1pl6A02	A:159-297
1b	1pl6B02	B:159-297
1c	1pl6C02	C:159-297
1d	1pl6D02	D:159-297

Architecture: Alpha-Beta Complex (3881)

Topology: Quinone Oxidoreductase; Chain A, domain 1 (131)

Homologous Superfamily: Medium-chain alcohol dehydrogenases, catalytic domain (131)

Human (Homo sapiens) (30)

2a	1pl6A01	A:1-158,A:298-356
2b	1pl6B01	B:1-158,B:298-356
2c	1pl6C01	C:1-158,C:298-356
2d	1pl6D01	D:1-158,D:298-356

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: GroES (70)

Family: ADH_N (62)

Homo sapiens (Human) (18)

1a	ADH_N-1pl6D01	D:31-142
1b	ADH_N-1pl6D02	D:31-142
1c	ADH_N-1pl6D03	D:31-142
1d	ADH_N-1pl6D04	D:31-142

Clan: NADP_Rossmann (1239)

Family: ADH_zinc_N (75)

Homo sapiens (Human) (24)

2a	ADH_zinc_N-1pl6D05	D:182-312
2b	ADH_zinc_N-1pl6D06	D:182-312
2c	ADH_zinc_N-1pl6D07	D:182-312
2d	ADH_zinc_N-1pl6D08	D:182-312

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (DHSO_HUMAN | Q00796)

molecular function
	GO:0046526	D-xylulose reductase activity	Catalysis of the reaction: NAD(+) + xylitol = D-xylulose + H(+) + NADH.
	GO:0003939	L-iditol 2-dehydrogenase activity	Catalysis of the reaction: L-iditol + NAD+ = L-sorbose + NADH + H+.
	GO:0051287	NAD binding	Interacting selectively and non-covalently with nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0051160	L-xylitol catabolic process	The chemical reactions and pathways resulting in the breakdown of L-xylitol, a five-carbon sugar alcohol derived from xylose by reduction of the carbonyl group.
	GO:0051164	L-xylitol metabolic process	The chemical reactions and pathways involving L-xylitol, a five-carbon sugar alcohol derived from xylose by reduction of the carbonyl group. It is as sweet as sucrose and is used as a noncariogenic sweetner and as a sugar substitute in diabetic diets.
	GO:0030317	flagellated sperm motility	Any process involved in the controlled movement of a flagellated sperm cell.
	GO:0046370	fructose biosynthetic process	The chemical reactions and pathways resulting in the formation of fructose, the ketohexose arabino-2-hexulose.
	GO:0006006	glucose metabolic process	The chemical reactions and pathways involving glucose, the aldohexose gluco-hexose. D-glucose is dextrorotatory and is sometimes known as dextrose; it is an important source of energy for living organisms and is found free as well as combined in homo- and hetero-oligosaccharides and polysaccharides.
	GO:0019640	glucuronate catabolic process to xylulose 5-phosphate	The chemical reactions and pathways resulting in the breakdown of glucuronate into other compounds, including xylulose 5-phosphate.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0046686	response to cadmium ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cadmium (Cd) ion stimulus.
	GO:0046688	response to copper ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a copper ion stimulus.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0009725	response to hormone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
	GO:0031667	response to nutrient levels	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus reflecting the presence, absence, or concentration of nutrients.
	GO:0006970	response to osmotic stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating an increase or decrease in the concentration of solutes outside the organism or cell.
	GO:0006062	sorbitol catabolic process	The chemical reactions and pathways resulting in the breakdown of sorbitol (D-glucitol), one of the ten stereoisomeric hexitols. It can be derived from glucose by reduction of the aldehyde group.
	GO:0006060	sorbitol metabolic process	The chemical reactions and pathways involving sorbitol (D-glucitol), one of the ten stereoisomeric hexitols. It can be derived from glucose by reduction of the aldehyde group.
cellular component
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005929	cilium	A specialized eukaryotic organelle that consists of a filiform extrusion of the cell surface and of some cytoplasmic parts. Each cilium is largely bounded by an extrusion of the cytoplasmic (plasma) membrane, and contains a regular longitudinal array of microtubules, anchored to a basal body.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031966	mitochondrial membrane	Either of the lipid bilayers that surround the mitochondrion and form the mitochondrial envelope.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0031514	motile cilium	A cilium which may have a variable arrangement of axonemal microtubules and also contains molecular motors. It may beat with a whip-like pattern that promotes cell motility or transport of fluids and other cells across a cell surface, such as on epithelial cells that line the lumenal ducts of various tissues; or they may display a distinct twirling motion that directs fluid flow asymmetrically across the cellular surface to affect asymmetric body plan organization. Motile cilia can be found in single as well as multiple copies per cell.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		572	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Pro A:122 - Pro A:123	[ RasMol ]
		Pro B:122 - Pro B:123	[ RasMol ]
		Pro C:122 - Pro C:123	[ RasMol ]
		Pro D:122 - Pro D:123	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1pl6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DHSO_HUMAN \| Q00796
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.14
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	DHSO_HUMAN \| Q00796
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	DHSO_HUMAN \| Q00796	:	1pl7 1pl8

1pl7	SDH APO FORM
1pl8	SDH/NAD+ COMPLEX

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 44)

Sites (12, 12)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 8)

PROSITE Motifs (1, 4)

Exons (9, 36)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (2, 8)

Pfam Domains (2, 8)

Gene Ontology (32, 32)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File