|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1PFS) |
(no "Site" information available for 1PFS) |
(no "SS Bond" information available for 1PFS) |
(no "Cis Peptide Bond" information available for 1PFS) |
(no "SAP(SNP)/Variant" information available for 1PFS) |
(no "PROSITE Motif" information available for 1PFS) |
(no "Exon" information available for 1PFS) |
NMR StructureChain A from PDB Type:PROTEIN Length:78 aligned with G5P_BPPF3 | P03672 from UniProtKB/Swiss-Prot Length:78 Alignment length:78 10 20 30 40 50 60 70 G5P_BPPF3 1 MNIQITFTDSVRQGTSAKGNPYTFQEGFLHLEDKPFPLQCQFFVESVIPAGSYQVPYRINVNNGRPELAFDFKAMKRA 78 SCOP domains d1pfsa_ A: Gene V protein SCOP domains CATH domains 1pfsA00 A:1-78 Nucleic acid-binding proteins CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------ Transcript 1pfs A 1 MNIQITFTDSVRQGTSAKGNPYTFQEGFLHLEDKPHPLQCQFFVESVIPAGSYQVPYRINVNNGRPELAFDFKAMKRA 78 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:78 aligned with G5P_BPPF3 | P03672 from UniProtKB/Swiss-Prot Length:78 Alignment length:78 10 20 30 40 50 60 70 G5P_BPPF3 1 MNIQITFTDSVRQGTSAKGNPYTFQEGFLHLEDKPFPLQCQFFVESVIPAGSYQVPYRINVNNGRPELAFDFKAMKRA 78 SCOP domains d1pfsb_ B: Gene V protein SCOP domains CATH domains 1pfsB00 B:1-78 Nucleic acid-binding proteins CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------ Transcript 1pfs B 1 MNIQITFTDSVRQGTSAKGNPYTFQEGFLHLEDKPHPLQCQFFVESVIPAGSYQVPYRINVNNGRPELAFDFKAMKRA 78 10 20 30 40 50 60 70
|
NMR Structure |
NMR Structure |
(no "Pfam Domain" information available for 1PFS) |
NMR Structure(hide GO term definitions) Chain A,B (G5P_BPPF3 | P03672)
|
|
|
|
|
|
|