![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1PE3) |
(no "Site" information available for 1PE3) |
NMR Structure
|
(no "Cis Peptide Bond" information available for 1PE3) |
(no "SAP(SNP)/Variant" information available for 1PE3) |
NMR Structure (2, 4)
|
(no "Exon" information available for 1PE3) |
NMR StructureChain 1 from PDB Type:PROTEIN Length:59 aligned with TFF3_HUMAN | Q07654 from UniProtKB/Swiss-Prot Length:80 Alignment length:59 31 41 51 61 71 TFF3_HUMAN 22 EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF 80 SCOP domains d1pe31_ 1: Intestinal trefoil factor SCOP domains CATH domains 1pe3100 1:1-59 Spasmolytic Protein, domain 1 CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE (1) --------P_TREFOIL_2 PDB: 1:9-52 UniProt: 30-73 ------- PROSITE (1) PROSITE (2) -----------------P_TREFOIL_1 --------------------- PROSITE (2) Transcript ----------------------------------------------------------- Transcript 1pe3 1 1 EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF 59 10 20 30 40 50 Chain 2 from PDB Type:PROTEIN Length:59 aligned with TFF3_HUMAN | Q07654 from UniProtKB/Swiss-Prot Length:80 Alignment length:59 31 41 51 61 71 TFF3_HUMAN 22 EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF 80 SCOP domains d1pe32_ 2: Intestinal trefoil factor SCOP domains CATH domains 1pe3200 2:1-59 Spasmolytic Protein, domain 1 CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE (1) --------P_TREFOIL_2 PDB: 2:9-52 UniProt: 30-73 ------- PROSITE (1) PROSITE (2) -----------------P_TREFOIL_1 --------------------- PROSITE (2) Transcript ----------------------------------------------------------- Transcript 1pe3 2 1 EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF 59 10 20 30 40 50
|
NMR Structure |
NMR Structure |
(no "Pfam Domain" information available for 1PE3) |
NMR Structure(hide GO term definitions) Chain 1,2 (TFF3_HUMAN | Q07654)
|
|
|
|
|
|
|