|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1PCF) |
Sites (0, 0)| (no "Site" information available for 1PCF) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1PCF) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1PCF) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1PCF) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1PCF) |
Exons (3, 24)
Asymmetric Unit (3, 24)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:66 aligned with TCP4_HUMAN | P53999 from UniProtKB/Swiss-Prot Length:127 Alignment length:66 71 81 91 101 111 121 TCP4_HUMAN 62 NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 SCOP domains d1pcfa_ A: Transcriptional coactivator PC4 C-terminal domain SCOP domains CATH domains 1pcfA00 A:62-127 Transcriptional Coactivator Pc4; Chain A CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript 1 (1) 1.7b------------------------------------Exon 1.10k PDB: A:102-127 Transcript 1 (1) Transcript 1 (2) ----Exon 1.9b PDB: A:66-102 ------------------------- Transcript 1 (2) 1pcf A 62 AMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 71 81 91 101 111 121 Chain B from PDB Type:PROTEIN Length:66 aligned with TCP4_HUMAN | P53999 from UniProtKB/Swiss-Prot Length:127 Alignment length:66 71 81 91 101 111 121 TCP4_HUMAN 62 NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 SCOP domains d1pcfb_ B: Transcriptional coactivator PC4 C-terminal domain SCOP domains CATH domains 1pcfB00 B:62-127 Transcriptional Coactivator Pc4; Chain A CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript 1 (1) 1.7b------------------------------------Exon 1.10k PDB: B:102-127 Transcript 1 (1) Transcript 1 (2) ----Exon 1.9b PDB: B:66-102 ------------------------- Transcript 1 (2) 1pcf B 62 AMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 71 81 91 101 111 121 Chain C from PDB Type:PROTEIN Length:66 aligned with TCP4_HUMAN | P53999 from UniProtKB/Swiss-Prot Length:127 Alignment length:66 71 81 91 101 111 121 TCP4_HUMAN 62 NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 SCOP domains d1pcfc_ C: Transcriptional coactivator PC4 C-terminal domain SCOP domains CATH domains 1pcfC00 C:62-127 Transcriptional Coactivator Pc4; Chain A CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript 1 (1) 1.7b------------------------------------Exon 1.10k PDB: C:102-127 Transcript 1 (1) Transcript 1 (2) ----Exon 1.9b PDB: C:66-102 ------------------------- Transcript 1 (2) 1pcf C 62 AMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 71 81 91 101 111 121 Chain D from PDB Type:PROTEIN Length:66 aligned with TCP4_HUMAN | P53999 from UniProtKB/Swiss-Prot Length:127 Alignment length:66 71 81 91 101 111 121 TCP4_HUMAN 62 NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 SCOP domains d1pcfd_ D: Transcriptional coactivator PC4 C-terminal domain SCOP domains CATH domains 1pcfD00 D:62-127 Transcriptional Coactivator Pc4; Chain A CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript 1 (1) 1.7b------------------------------------Exon 1.10k PDB: D:102-127 Transcript 1 (1) Transcript 1 (2) ----Exon 1.9b PDB: D:66-102 ------------------------- Transcript 1 (2) 1pcf D 62 AMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 71 81 91 101 111 121 Chain E from PDB Type:PROTEIN Length:66 aligned with TCP4_HUMAN | P53999 from UniProtKB/Swiss-Prot Length:127 Alignment length:66 71 81 91 101 111 121 TCP4_HUMAN 62 NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 SCOP domains d1pcfe_ E: Transcriptional coactivator PC4 C-terminal domain SCOP domains CATH domains 1pcfE00 E:62-127 Transcriptional Coactivator Pc4; Chain A CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript 1 (1) 1.7b------------------------------------Exon 1.10k PDB: E:102-127 Transcript 1 (1) Transcript 1 (2) ----Exon 1.9b PDB: E:66-102 ------------------------- Transcript 1 (2) 1pcf E 62 AMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 71 81 91 101 111 121 Chain F from PDB Type:PROTEIN Length:66 aligned with TCP4_HUMAN | P53999 from UniProtKB/Swiss-Prot Length:127 Alignment length:66 71 81 91 101 111 121 TCP4_HUMAN 62 NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 SCOP domains d1pcff_ F: Transcriptional coactivator PC4 C-terminal domain SCOP domains CATH domains 1pcfF00 F:62-127 Transcriptional Coactivator Pc4; Chain A CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript 1 (1) 1.7b------------------------------------Exon 1.10k PDB: F:102-127 Transcript 1 (1) Transcript 1 (2) ----Exon 1.9b PDB: F:66-102 ------------------------- Transcript 1 (2) 1pcf F 62 AMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 71 81 91 101 111 121 Chain G from PDB Type:PROTEIN Length:66 aligned with TCP4_HUMAN | P53999 from UniProtKB/Swiss-Prot Length:127 Alignment length:66 71 81 91 101 111 121 TCP4_HUMAN 62 NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 SCOP domains d1pcfg_ G: Transcriptional coactivator PC4 C-terminal domain SCOP domains CATH domains 1pcfG00 G:62-127 Transcriptional Coactivator Pc4; Chain A CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript 1 (1) 1.7b------------------------------------Exon 1.10k PDB: G:102-127 Transcript 1 (1) Transcript 1 (2) ----Exon 1.9b PDB: G:66-102 ------------------------- Transcript 1 (2) 1pcf G 62 AMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 71 81 91 101 111 121 Chain H from PDB Type:PROTEIN Length:66 aligned with TCP4_HUMAN | P53999 from UniProtKB/Swiss-Prot Length:127 Alignment length:66 71 81 91 101 111 121 TCP4_HUMAN 62 NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 SCOP domains d1pcfh_ H: Transcriptional coactivator PC4 C-terminal domain SCOP domains CATH domains 1pcfH00 H:62-127 Transcriptional Coactivator Pc4; Chain A CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------ PROSITE Transcript 1 (1) 1.7b------------------------------------Exon 1.10k PDB: H:102-127 Transcript 1 (1) Transcript 1 (2) ----Exon 1.9b PDB: H:66-102 ------------------------- Transcript 1 (2) 1pcf H 62 AMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL 127 71 81 91 101 111 121
|
||||||||||||||||||||
SCOP Domains (1, 8)| Asymmetric Unit |
CATH Domains (1, 8)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1PCF) |
Gene Ontology (15, 15)|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D,E,F,G,H (TCP4_HUMAN | P53999)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|