Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE C-TERMINAL DOMAIN OF THE HUMAN EEF1BGAMMA SUBUNIT
 
Authors :  S. Vanwetswinkel, J. Kriek, G. R. Andersen, P. Guntert, J. Dijk, G. W. Canters, G. Siegal
Date :  15 May 03  (Deposition) - 15 Jul 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Alpha/Beta, Translation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Vanwetswinkel, J. Kriek, G. R. Andersen, J. Dijk, G. Siegal
1H, (15)N And (13)C Resonance Assignments Of The Highly Conserved 19 Kda C-Terminal Domain From Human Elongation Factor 1Bgamma.
J. Biomol. Nmr V. 26 189 2003
PubMed-ID: 12766415  |  Reference-DOI: 10.1023/A:1023504611632
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ELONGATION FACTOR 1-GAMMA
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET16B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentC-TERMINAL DOMAIN (RESIDUES 276-437)
    GeneEEF1G OR EF1G
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymEF-1-GAMMA, EEF-1B GAMMA, PRO1608

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1PBU)

(-) Sites  (0, 0)

(no "Site" information available for 1PBU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1PBU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1PBU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PBU)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF1G_CPS50040 Elongation factor 1 (EF-1) gamma C-terminal domain profile.EF1G_HUMAN276-437  1A:276-437

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.3aENST000003292513aENSE00001715491chr11:62341445-62341303143EF1G_HUMAN1-440--
1.3eENST000003292513eENSE00001329512chr11:62340214-62340056159EF1G_HUMAN5-57530--
1.4ENST000003292514ENSE00000722679chr11:62339373-6233931064EF1G_HUMAN58-79220--
1.5bENST000003292515bENSE00000722683chr11:62339154-62339012143EF1G_HUMAN79-126480--
1.6dENST000003292516dENSE00000722688chr11:62338580-62338437144EF1G_HUMAN127-174480--
1.7ENST000003292517ENSE00000722691chr11:62335000-62334871130EF1G_HUMAN175-218440--
1.8aENST000003292518aENSE00000722696chr11:62334482-62334278205EF1G_HUMAN218-286691A:276-28611
1.9ENST000003292519ENSE00001785335chr11:62327926-62327754173EF1G_HUMAN286-344591A:286-34459
1.10ENST0000032925110ENSE00001725266chr11:62327665-62327541125EF1G_HUMAN344-385421A:344-38542
1.11bENST0000032925111bENSE00002150889chr11:62327309-62327073237EF1G_HUMAN386-437521A:386-43752

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:162
 aligned with EF1G_HUMAN | P26641 from UniProtKB/Swiss-Prot  Length:437

    Alignment length:162
                                   285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435  
           EF1G_HUMAN   276 AKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 437
               SCOP domains d1pbua_ A: Elongation factor 1-gamma C-terminal domain                                                                                                             SCOP domains
               CATH domains 1pbuA00 A:276-437 eEF1-gamma domain                                                                                                                                CATH domains
               Pfam domains EF1G-1pbuA01 A:276-381                                                                                    -------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhh......hhhhhhhhhhhhhhhhhhhhhhhh.......eeeee...hhhhh....hhhhhhhhhhhhhhhhhh.eee..eee......eeeeeeee.....hhhhhhhhh.hhhhh..ee.....hhhhhhhhhhhhh............ee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE EF1G_C  PDB: A:276-437 UniProt: 276-437                                                                                                                            PROSITE
           Transcript 1 (1) Exon 1.8a  ---------------------------------------------------------Exon 1.10  PDB: A:344-385 UniProt: 344-385Exon 1.11b  PDB: A:386-437 UniProt: 386-437          Transcript 1 (1)
           Transcript 1 (2) ----------Exon 1.9  PDB: A:286-344 UniProt: 286-344                  --------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1pbu A 276 AKDPFAHLPKSTFALDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 437
                                   285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (13, 13)

NMR Structure(hide GO term definitions)
Chain A   (EF1G_HUMAN | P26641)
molecular function
    GO:0004364    glutathione transferase activity    Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003746    translation elongation factor activity    Functions in chain elongation during polypeptide synthesis at the ribosome.
biological process
    GO:0006749    glutathione metabolic process    The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
    GO:0009615    response to virus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a virus.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006414    translational elongation    The successive addition of amino acid residues to a nascent polypeptide chain during protein biosynthesis.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1pbu)
 
  Sites
(no "Sites" information available for 1pbu)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1pbu)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1pbu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  EF1G_HUMAN | P26641
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  EF1G_HUMAN | P26641
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        EF1G_HUMAN | P266415dqs 5jpo

(-) Related Entries Specified in the PDB File

5628 CHEMICAL SHIFT ASSIGNMENTS