|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)| Asymmetric Unit (2, 5) Biological Unit 1 (1, 4) Biological Unit 2 (1, 8) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1PBJ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1PBJ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1PBJ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1PBJ) |
Exons (0, 0)| (no "Exon" information available for 1PBJ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:120 aligned with O27659_METTH | O27659 from UniProtKB/TrEMBL Length:125 Alignment length:120 11 21 31 41 51 61 71 81 91 101 111 121 O27659_METTH 2 RVEDVMVTDVDTIDITASLEDVLRNYVENAKGSSVVVKEGVRVGIVTTWDVLEAIAEGDDLAEVKVWEVMERDLVTISPRATIKEAAEKMVKNVVWRLLVEEDDEIIGVISATDILRAKM 121 SCOP domains d1pbja3 A:2-121 Hypothetical protein MTH1622 SCOP domains CATH domains 1pbjA00 A:2-120 CBS-domain - CATH domains Pfam domains (1) -----------------------------------------------------------------CBS-1pbjA01 A:67-121 Pfam domains (1) Pfam domains (2) -----------------------------------------------------------------CBS-1pbjA02 A:67-121 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript 1pbj A 2 RVEDVmVTDVDTIDITASLEDVLRNYVENAKGSSVVVKEGVRVGIVTTWDVLEAIAEGDDLAEVKVWEVmERDLVTISPRATIKEAAEKmVKNVVWRLLVEEDDEIIGVISATDILRAKm 121 | 11 21 31 41 51 61 71 81 91 101 111 121 7-MSE 71-MSE 91-MSE 121-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1PBJ)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|