Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A BOWMAN-BIRK INHIBITOR FROM PEA SEEDS
 
Authors :  I. Li De La Sierra, S. Brunie
Date :  20 Aug 98  (Deposition) - 27 Jan 99  (Release) - 16 Nov 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Bowman-Birk Inhibitor, Trypsin Inhibitor, Chymotrypsin Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  I. Li De La Sierra, L. Quillien, P. Flecker, J. Gueguen, S. Brunie
Dimeric Crystal Structure Of A Bowman-Birk Protease Inhibitor From Pea Seeds.
J. Mol. Biol. V. 285 1195 1999
PubMed-ID: 9887273  |  Reference-DOI: 10.1006/JMBI.1998.2351

(-) Compounds

Molecule 1 - BOWMAN-BIRK PROTEINASE INHIBITOR
    Chains: A, B
    Organ: SEEDS
    Organism Common: PEA
    Organism Scientific: PISUM SATIVUM
    Organism Taxid: 3888

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1PBI)

(-) Sites  (0, 0)

(no "Site" information available for 1PBI)

(-) SS Bonds  (14, 14)

Asymmetric Unit
No.Residues
1A:8 -A:62
2A:9 -A:24
3A:12 -A:58
4A:14 -A:22
5A:32 -A:39
6A:36 -A:51
7A:41 -A:49
8B:8 -B:62
9B:9 -B:24
10B:12 -B:58
11B:14 -B:22
12B:32 -B:39
13B:36 -B:51
14B:41 -B:49

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Asn A:18 -Pro A:19
2Asn A:45 -Pro A:46
3Asn B:18 -Pro B:19
4Asn B:45 -Pro B:46

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PBI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1PBI)

(-) Exons   (0, 0)

(no "Exon" information available for 1PBI)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:68
 aligned with IBBB_PEA | P56679 from UniProtKB/Swiss-Prot  Length:72

    Alignment length:68
                                    14        24        34        44        54        64        
              IBBB_PEA    5 KSACCDTCLCTKSNPPTCRCVDVGETCHSACLSCICAYSNPPKCQCFDTQKFCYKACHNSELEEVIKN 72
               SCOP domains d1pbia_ A: Bowman-Birk inhibitor, BBI                                SCOP domains
               CATH domains 1pbiA00 A:5-73 Cysteine Protease (Bromelain) Inhibitor, subunit H    CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eee.......eee.............eeee.....eeee...................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                  1pbi A  5 KSACCDTCLCTKSNPPTCRCVDVGETCHSACLSCICAYSNPPKCQCFDTQKFCYKQCHNSELEEVIKN 73
                                    14        24   ||   35        45        55        65        
                                                  28|                                           
                                                   30                                           


Chain B from PDB  Type:PROTEIN  Length:68
 aligned with IBBB_PEA | P56679 from UniProtKB/Swiss-Prot  Length:72

    Alignment length:68
                                    14        24        34        44        54        64        
              IBBB_PEA    5 KSACCDTCLCTKSNPPTCRCVDVGETCHSACLSCICAYSNPPKCQCFDTQKFCYKACHNSELEEVIKN 72
               SCOP domains d1pbib_ B: Bowman-Birk inhibitor, BBI                                SCOP domains
               CATH domains 1pbiB00 B:5-73 Cysteine Protease (Bromelain) Inhibitor, subunit H    CATH domains
           Pfam domains (1) -----------------------------Bowman-Birk_leg-1pbiB01  -------------- Pfam domains (1)
           Pfam domains (2) -----------------------------Bowman-Birk_leg-1pbiB02  -------------- Pfam domains (2)
           Pfam domains (3) -----------------------------Bowman-Birk_leg-1pbiB03  -------------- Pfam domains (3)
           Pfam domains (4) -----------------------------Bowman-Birk_leg-1pbiB04  -------------- Pfam domains (4)
         Sec.struct. author .......eee.......eee.............eeee.....eeee...................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------- Transcript
                  1pbi B  5 KSACCDTCLCTKSNPPTCRCVDVGETCHSACLSCICAYSNPPKCQCFDTQKFCYKQCHNSELEEVIKN 73
                                    14        24   ||   35        45        55        65        
                                                  28|                                           
                                                   30
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: no clan defined [family: Bowman-Birk_leg] (11)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (IBBB_PEA | P56679)
molecular function
    GO:0030414    peptidase inhibitor activity    Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
    GO:0004867    serine-type endopeptidase inhibitor activity    Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
    GO:0010951    negative regulation of endopeptidase activity    Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0010466    negative regulation of peptidase activity    Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1pbi)
 
  Sites
(no "Sites" information available for 1pbi)
 
  Cis Peptide Bonds
    Asn A:18 - Pro A:19   [ RasMol ]  
    Asn A:45 - Pro A:46   [ RasMol ]  
    Asn B:18 - Pro B:19   [ RasMol ]  
    Asn B:45 - Pro B:46   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1pbi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IBBB_PEA | P56679
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IBBB_PEA | P56679
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1PBI)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1PBI)