|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1PA4) |
Sites (0, 0)| (no "Site" information available for 1PA4) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1PA4) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1PA4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1PA4) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1PA4) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:96 aligned with RBFA_MYCPN | P75589 from UniProtKB/Swiss-Prot Length:116 Alignment length:96 15 25 35 45 55 65 75 85 95 RBFA_MYCPN 6 KERLENDIIRLINRTVIHEIYNETVKTGHVTHVKLSDDLLHVTVYLDCYNREQIDRVVGAFNQAKGVFSRVLAHNLYLAKAVQIHFVKDKAIDNAM 101 SCOP domains d1pa4a_ A: Ribosome-binding factor A, RbfA SCOP domains CATH domains 1pa4A00 A:6-101 [code=3.30.300.20, no name defined] CATH domains Pfam domains RBFA-1pa4A01 A:6-101 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE -------------------------------------------------------------------RBFA PDB: A:73-94 ------- PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 1pa4 A 6 KERLENDIIRLINRTVIHEIYNETVKTGHVTHVKLSDDLLHVTVYLDCYNREQIDRVVGAFNQAKGVFSRVLAHNLYLAKAVQIHFVKDKAIDNAM 101 15 25 35 45 55 65 75 85 95
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (RBFA_MYCPN | P75589)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|