Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE LOW MOLECULAR WEIGHT PROTEIN TYROSINE PHOSPHATASE FROM TRITRICHOMONAS FOETUS
 
Authors :  C. L. Gustafson, C. V. Stauffacher, K. Hallenga, R. L. Van Etten
Date :  06 May 03  (Deposition) - 15 Jun 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (21x)
Keywords :  Low Molecular Weight Protein Tyrosine Phosphatase, Tritrichomonas Foetus, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. L. Gustafson, C. V. Stauffacher, K. Hallenga, R. L. Van Etten
Solution Structure Of The Low-Molecular-Weight Protein Tyrosine Phosphatase From Tritrichomonas Foetus Reveals A Flexible Phosphate Binding Loop.
Protein Sci. V. 14 2515 2005
PubMed-ID: 16195543  |  Reference-DOI: 10.1110/PS.051618805
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN TYROSINE PHOSPHATASE
    ChainsA
    EC Number3.1.3.48
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET23D
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    MutationYES
    Organism ScientificTRITRICHOMONAS FOETUS
    Organism Taxid5724

 Structural Features

(-) Chains, Units

  
NMR Structure (21x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1P8A)

(-) Sites  (0, 0)

(no "Site" information available for 1P8A)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1P8A)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1P8A)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1P8A)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1P8A)

(-) Exons   (0, 0)

(no "Exon" information available for 1P8A)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:146
 aligned with O00810_TRIFO | O00810 from UniProtKB/TrEMBL  Length:147

    Alignment length:146
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141      
         O00810_TRIFO     2 SAEKKAVLFVCLGNICRSPACEGICRDMVGDKLIIDSAATSGFHVGQSPDTRSQKVCKSNGVDISKQRARQITKADFSKFDVIAALDQSILSDINSMKPSNCRAKVVLFNPPNGVDDPYYSSDGFPTMFASISKEMKPFLTEHGLI 147
               SCOP domains d1p8aa_ A: Tyrosine phosphatase                                                                                                                    SCOP domains
               CATH domains 1p8aA00 A:1-146  [code=3.40.50.270, no name defined]                                                                                               CATH domains
               Pfam domains ------LMWPc-1p8aA01 A:7-140                                                                                                                 ------ Pfam domains
         Sec.struct. author ......eeee.........hhhhhhhhhhh.....eee...........hhhhhhhhhhhh............hhhhhh..eeee.hhhhhhhhhhhh......eeee...............hhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1p8a A   1 AAEKKAVLFVCLGNICRSPACEGICRDMVGDKLIIDSAATSGFHVGQSPDTRSQKVCKSNGVDISKQRARQITKADFSKFDVIAALDQSILSDINSMKPSNCRAKVVLFNPPNGVDDPYYSSDGFPTMFASISKEMKPFLTEHGLI 146
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (O00810_TRIFO | O00810)
molecular function
    GO:0004725    protein tyrosine phosphatase activity    Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
    GO:0035335    peptidyl-tyrosine dephosphorylation    The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
    GO:0006470    protein dephosphorylation    The process of removing one or more phosphoric residues from a protein.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1p8a)
 
  Sites
(no "Sites" information available for 1p8a)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1p8a)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1p8a
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O00810_TRIFO | O00810
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.1.3.48
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  O00810_TRIFO | O00810
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1P8A)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1P8A)