1P4R - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN ATIC IN COMPLEX WITH FOLATE-BASED INHIBITOR BW1540U88UD

Authors :   C. -G. Cheong, S. E. Greasley, P. A. Horton, G. P. Beardsley, I. A. Wilson

Date :   23 Apr 03 (Deposition) - 30 Mar 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.55

Chains :   Asym./Biol. Unit : A,B

Keywords :   Antifolate, Atic, Purine Biosynthesis, Bw1540U88Ud, Transferase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. -G. Cheong, D. W. Wolan, S. E. Greasley, P. A. Horton, G. P. Beardsley, I. A. Wilson
Crystal Structures Of Human Bifunctional Enzyme Aminoimidazole-4-Carboxamide Ribonucleotide Transformylase/Imp Cyclohydrolase In Complex With Potent Sulfonyl-Containing Antifolates
J. Biol. Chem. V. 279 18034 2004
PubMed-ID: 14966129 | Reference-DOI: 10.1074/JBC.M313691200
(for further references see the PDB file header)

Molecule 1 - BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
	Chains	:	A, B
	EC Number	:	2.1.2.3, 3.5.4.10
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28A
	Expression System Strain	:	TUNER DE3
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	ATIC CDNA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	ATIC

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (4, 7)

No.	Name	Count	Type	Full Name
1	354	2	Ligand/Ion	N-[(S)-(4-{[(2-AMINO-4-HYDROXYQUINAZOLIN-6-YL)(DIHYDROXY)-LAMBDA~4~-SULFANYL]AMINO}PHENYL)(HYDROXY)METHYL]-L-GLUTAMIC ACID
2	AMZ	2	Ligand/Ion	AMINOIMIDAZOLE 4-CARBOXAMIDE RIBONUCLEOTIDE
3	K	2	Ligand/Ion	POTASSIUM ION
4	XMP	1	Ligand/Ion	XANTHOSINE-5'-MONOPHOSPHATE

Asymmetric Unit (7, 7)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	VAL A:425 , THR A:428 , SER A:430 , SER A:432 , ASP A:539 , LEU A:589 , HIS A:591	BINDING SITE FOR RESIDUE K A 1001
2	AC2	SOFTWARE	VAL B:425 , THR B:428 , SER B:430 , SER B:432 , ASP B:539 , LEU B:589 , HIS B:591	BINDING SITE FOR RESIDUE K B 1002
3	AC3	SOFTWARE	ASN A:431 , ARG A:451 , ALA A:540 , PHE A:541 , ARG A:588 , PHE A:590 , 354 A:1801 , HOH A:1911 , HOH A:1930 , ARG B:207 , TYR B:208 , ASN B:239 , LYS B:266 , HIS B:267 , GLY B:316 , ASP B:339 , HOH B:1805 , HOH B:1818 , HOH B:1838 , HOH B:1938	BINDING SITE FOR RESIDUE AMZ A 1701
4	AC4	SOFTWARE	ARG A:207 , TYR A:208 , LYS A:266 , HIS A:267 , GLY A:316 , ASP A:339 , HOH A:1903 , HOH A:1908 , HOH A:1931 , ASN B:431 , ARG B:451 , ALA B:540 , PHE B:541 , ARG B:588 , PHE B:590 , 354 B:1802 , HOH B:1855 , HOH B:1859	BINDING SITE FOR RESIDUE AMZ B 1702
5	AC5	SOFTWARE	ASN A:431 , GLN A:449 , SER A:450 , ARG A:451 , ILE A:452 , PHE A:541 , PRO A:543 , PHE A:544 , ASP A:546 , ASN A:547 , SER A:565 , ALA A:566 , AMZ A:1701 , HOH A:1947 , HOH A:1952 , HOH A:1962 , LYS B:266 , MET B:312 , PHE B:315 , GLY B:316 , ASN B:489 , HOH B:1815	BINDING SITE FOR RESIDUE 354 A 1801
6	AC6	SOFTWARE	LYS A:266 , MET A:312 , PHE A:315 , ASN A:489 , ASN B:431 , GLN B:449 , SER B:450 , ARG B:451 , ILE B:452 , PHE B:541 , PRO B:543 , PHE B:544 , ASP B:546 , ASN B:547 , SER B:565 , ALA B:566 , AMZ B:1702 , HOH B:1856 , HOH B:1858 , HOH B:1932	BINDING SITE FOR RESIDUE 354 B 1802
7	AC7	SOFTWARE	SER A:10 , VAL A:11 , SER A:12 , LYS A:14 , SER A:34 , GLY A:36 , THR A:37 , ARG A:64 , LYS A:66 , THR A:67 , LEU A:68 , CYS A:101 , ASN A:102 , LEU A:103 , TYR A:104 , ASP A:125 , ILE A:126 , GLY A:127 , GLY A:128	BINDING SITE FOR RESIDUE XMP A 1901

(no "SS Bond" information available for 1P4R)

Asymmetric/Biological Unit

No.	Residues
1	Thr A:215	-	Pro A:216
2	Ser A:430	-	Asn A:431
3	Thr B:215	-	Pro B:216
4	Ser B:430	-	Asn B:431

Asymmetric/Biological Unit (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_019306	T	116	S	PUR9_HUMAN	Polymorphism	2372536	A/B	T	116	S
2	UniProt	VAR_019307	K	426	R	PUR9_HUMAN	Disease (AICAR)	121434478	A/B	K	426	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1P4R)

Asymmetric/Biological Unit (16, 32)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000236959	1a	ENSE00001914660	chr2:216176540-216176884	345	PUR9_HUMAN	1-7	7	2	A:4-7 B:5-7	4 3
1.1g	ENST00000236959	1g	ENSE00001646681	chr2:216177221-216177347	127	PUR9_HUMAN	7-49	43	2	A:7-49 B:7-49	43 43
1.2b	ENST00000236959	2b	ENSE00001806771	chr2:216182880-216182956	77	PUR9_HUMAN	49-75	27	2	A:49-75 B:49-75	27 27
1.3	ENST00000236959	3	ENSE00001648662	chr2:216184388-216184454	67	PUR9_HUMAN	75-97	23	2	A:75-97 B:75-97	23 23
1.4b	ENST00000236959	4b	ENSE00001712436	chr2:216189964-216190052	89	PUR9_HUMAN	97-127	31	2	A:97-127 B:97-127	31 31
1.5b	ENST00000236959	5b	ENSE00001606333	chr2:216190710-216190861	152	PUR9_HUMAN	127-177	51	2	A:127-177 B:127-177	51 51
1.6	ENST00000236959	6	ENSE00002173380	chr2:216191545-216191701	157	PUR9_HUMAN	178-230	53	2	A:178-230 B:178-230	53 53
1.7	ENST00000236959	7	ENSE00001731167	chr2:216197105-216197230	126	PUR9_HUMAN	230-272	43	2	A:230-272 B:230-272	43 43
1.8	ENST00000236959	8	ENSE00001775272	chr2:216198073-216198180	108	PUR9_HUMAN	272-308	37	2	A:272-308 B:272-308	37 37
1.9b	ENST00000236959	9b	ENSE00001630599	chr2:216199642-216199727	86	PUR9_HUMAN	308-336	29	2	A:308-336 B:308-336	29 29
1.10b	ENST00000236959	10b	ENSE00001620932	chr2:216200758-216200847	90	PUR9_HUMAN	337-366	30	2	A:337-366 B:337-366	30 30
1.11c	ENST00000236959	11c	ENSE00001679432	chr2:216203502-216203630	129	PUR9_HUMAN	367-409	43	2	A:367-409 B:367-409	43 43
1.12a	ENST00000236959	12a	ENSE00001642683	chr2:216209502-216209594	93	PUR9_HUMAN	410-440	31	2	A:410-440 B:410-440	31 31
1.13a	ENST00000236959	13a	ENSE00001768906	chr2:216211482-216211664	183	PUR9_HUMAN	441-501	61	2	A:441-501 B:441-501	61 61
1.16b	ENST00000236959	16b	ENSE00001703750	chr2:216213817-216213972	156	PUR9_HUMAN	502-553	52	2	A:502-553 B:502-553	52 52
1.17c	ENST00000236959	17c	ENSE00001669993	chr2:216214259-216214486	228	PUR9_HUMAN	554-592	39	2	A:554-592 B:554-592	39 39

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:589
 aligned with PUR9_HUMAN | P31939 from UniProtKB/Swiss-Prot  Length:592

    Alignment length:589
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583         
           PUR9_HUMAN     4 GQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH 592
               SCOP domains d1p4ra1 A:4-200 IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC                                                                                                            d1p4ra2 A:201-592 AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC                                                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains 1p4rA04 A:4-197  [code=3.40.50.1380, no name defined]                                                                                                                                             -----------------------------1p4rA03 A:227-373  [code=3.40.140.20, no name defined]                                                                                             1p4rA02 A:374-475,A:519-584  [code=3.40.140.20, no name defined]                                      1p4rA01 A:476-518                          1p4rA02 A:374-475,A:519-584  [code=3.40.140.20, no name defined]  -------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.....hhhhhhhhhhhh..eeeehhhhhhhhhh....eeehhhhhh............hhhhhhhhhh..hhhhhhhhhhhh...eeeeee...hhhhhhhh...hhhhhhhh..hhhhhhhhhhhhh....eee.hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eee...........eeee.......eeeee...hhhhhhhhhhhhhhhhhhhhhhh..eeeeee..eeeeeee....hhhhhhhh.hhhhhhhhhhhhhhhhhhhhh.......eeeee....hhhhhhhhhh..eeeeee...hhhhhhhhhhhhhhh.eeeee........eeeeee..eeeeee......hhhhhh.........hhhhhhhhhhhhhhhhh.....eeeee..eeeeee....hhhhhhhhhhhhhhhhhhh.hhhhhh.......hhhhhhhhhhhhhhh...hhhhhhhhhhh........hhhhhhhhhhh...eeeee......hhhhhhhhh..eeeeeee....hhhhhhhhhhhh..eeeee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------S---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.1a-----------------------------------------Exon 1.2b  PDB: A:49-75    ---------------------Exon 1.4b  PDB: A:97-127       --------------------------------------------------Exon 1.6  PDB: A:178-230 UniProt: 178-230            -----------------------------------------Exon 1.8  PDB: A:272-308             ----------------------------Exon 1.10b  PDB: A:337-366    Exon 1.11c  PDB: A:367-409 UniProt: 367-409Exon 1.12a  PDB: A:410-440     Exon 1.13a  PDB: A:441-501 UniProt: 441-501                  Exon 1.16b  PDB: A:502-553 UniProt: 502-553         Exon 1.17c  PDB: A:554-592              Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.1g  PDB: A:7-49 UniProt: 7-49       -------------------------Exon 1.3  PDB: A:75-97 -----------------------------Exon 1.5b  PDB: A:127-177 UniProt: 127-177         ----------------------------------------------------Exon 1.7  PDB: A:230-272 UniProt: 230-272  -----------------------------------Exon 1.9b  PDB: A:308-336    ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1p4r A   4 GQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH 592
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583

Chain B from PDB  Type:PROTEIN  Length:588
 aligned with PUR9_HUMAN | P31939 from UniProtKB/Swiss-Prot  Length:592

    Alignment length:588
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584        
           PUR9_HUMAN     5 QLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH 592
               SCOP domains d1p4rb1 B:5-200 IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC                                                                                                           d1p4rb2 B:201-592 AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC                                                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains 1p4rB04 B:5-197  [code=3.40.50.1380, no name defined]                                                                                                                                            -----------------------------1p4rB03 B:227-373  [code=3.40.140.20, no name defined]                                                                                             1p4rB02 B:374-475,B:519-584  [code=3.40.140.20, no name defined]                                      1p4rB01 B:476-518                          1p4rB02 B:374-475,B:519-584  [code=3.40.140.20, no name defined]  -------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee....hhhhhhhhhhhh..eeeehhhhhhhhhhh...eeehhhhhh...hhhhh....hhhhhhhhhh..hhhhhhhhhhhh...eeeeeee..hhhhhhh....hhhhhhhh..hhhhhhhhhhhhh....eee.hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eee...........eeee.......eeeee...hhhhhhhhhhhhhhhhhhhhhhh..eeeee....eeeeee....hhhhhhhh.hhhhh...hhhhhhhhhhhhh.......eeeee....hhhhhhhhhh..eeeeee...hhhhhhhhhhhhhhh.eeeee........eeeeee..eeeeee......hhhhhh.........hhhhhhhhhhhhhhhhh.....eeeee..eeeeee....hhhhhhhhhhhhhhhhhhh.hhhhhh.......hhhhhhhhhhhhhh....hhhhhhhhhh.........hhhhhhhhhhh...eeeee......hhhhhhhhh..eeeeeee....hhhhhhhhhhhh..eeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------S---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------R---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.1-----------------------------------------Exon 1.2b  PDB: B:49-75    ---------------------Exon 1.4b  PDB: B:97-127       --------------------------------------------------Exon 1.6  PDB: B:178-230 UniProt: 178-230            -----------------------------------------Exon 1.8  PDB: B:272-308             ----------------------------Exon 1.10b  PDB: B:337-366    Exon 1.11c  PDB: B:367-409 UniProt: 367-409Exon 1.12a  PDB: B:410-440     Exon 1.13a  PDB: B:441-501 UniProt: 441-501                  Exon 1.16b  PDB: B:502-553 UniProt: 502-553         Exon 1.17c  PDB: B:554-592              Transcript 1 (1)
           Transcript 1 (2) --Exon 1.1g  PDB: B:7-49 UniProt: 7-49       -------------------------Exon 1.3  PDB: B:75-97 -----------------------------Exon 1.5b  PDB: B:127-177 UniProt: 127-177         ----------------------------------------------------Exon 1.7  PDB: B:230-272 UniProt: 230-272  -----------------------------------Exon 1.9b  PDB: B:308-336    ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1p4r B   5 QLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH 592
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Cytidine Deaminase; domain 2 (44)

Homologous Superfamily: [code=3.40.140.20, no name defined] (11)

Human (Homo sapiens) (3)

1a	1p4rA02	A:374-475,A:519-584
1b	1p4rA03	A:227-373
1c	1p4rB03	B:227-373
1d	1p4rB02	B:374-475,B:519-584

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.1380, no name defined] (29)

Human (Homo sapiens) (3)

2a	1p4rB04	B:5-197
2b	1p4rA04	A:4-197

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Helix Hairpins (718)

Homologous Superfamily: [code=1.10.287.440, no name defined] (11)

Human (Homo sapiens) (3)

3a	1p4rA01	A:476-518
3b	1p4rB01	B:476-518

(no "Pfam Domain" information available for 1P4R)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (PUR9_HUMAN | P31939)

molecular function
	GO:0003937	IMP cyclohydrolase activity	Catalysis of the reaction: IMP + H2O = 5-formamido-1-(5-phosphoribosyl)imidazole-4-carboxamide.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0004643	phosphoribosylaminoimidazolecarboxamide formyltransferase activity	Catalysis of the reaction: 10-formyltetrahydrofolate + 5'-phosphoribosyl-5-amino-4-imidazolecarboxamide = tetrahydrofolate + 5'-phosphoribosyl-5-formamido-4-imidazolecarboxamide.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006189	'de novo' IMP biosynthetic process	The chemical reactions and pathways resulting in the formation of IMP, inosine monophosphate, by the stepwise assembly of a purine ring on ribose 5-phosphate.
	GO:0031100	animal organ regeneration	The regrowth of a lost or destroyed animal organ.
	GO:0003360	brainstem development	The progression of the brainstem from its formation to the mature structure. The brainstem is the part of the brain that connects the brain with the spinal cord.
	GO:0021549	cerebellum development	The process whose specific outcome is the progression of the cerebellum over time, from its formation to the mature structure. The cerebellum is the portion of the brain in the back of the head between the cerebrum and the pons. In mice, the cerebellum controls balance for walking and standing, modulates the force and range of movement and is involved in the learning of motor skills.
	GO:0021987	cerebral cortex development	The progression of the cerebral cortex over time from its initial formation until its mature state. The cerebral cortex is the outer layered region of the telencephalon.
	GO:0046452	dihydrofolate metabolic process	The chemical reactions and pathways involving dihydrofolate, the dihydroxylated derivative of folate.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0006139	nucleobase-containing compound metabolic process	Any cellular metabolic process involving nucleobases, nucleosides, nucleotides and nucleic acids.
	GO:0009116	nucleoside metabolic process	The chemical reactions and pathways involving a nucleoside, a nucleobase linked to either beta-D-ribofuranose (a ribonucleoside) or 2-deoxy-beta-D-ribofuranose, (a deoxyribonucleoside), e.g. adenosine, guanosine, inosine, cytidine, uridine and deoxyadenosine, deoxyguanosine, deoxycytidine and thymidine (= deoxythymidine).
	GO:0006164	purine nucleotide biosynthetic process	The chemical reactions and pathways resulting in the formation of a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
	GO:0009168	purine ribonucleoside monophosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of purine ribonucleoside monophosphate, a compound consisting of a purine base linked to a ribose sugar esterified with phosphate on the sugar.
	GO:0010035	response to inorganic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an inorganic substance stimulus.
	GO:0009259	ribonucleotide metabolic process	The chemical reactions and pathways involving a ribonucleotide, a compound consisting of ribonucleoside (a base linked to a ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
	GO:0046654	tetrahydrofolate biosynthetic process	The chemical reactions and pathways resulting in the formation of tetrahydrofolate, 5,6,7,8-tetrahydrofolic acid, a folate derivative bearing additional hydrogens on the pterin group.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		354	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		AMZ	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		K	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		XMP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ser A:430 - Asn A:431	[ RasMol ]
		Ser B:430 - Asn B:431	[ RasMol ]
		Thr A:215 - Pro A:216	[ RasMol ]
		Thr B:215 - Pro B:216	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1p4r
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PUR9_HUMAN \| P31939
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.1.2.3
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	3.5.4.10
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	608688
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PUR9_HUMAN \| P31939
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PUR9_HUMAN \| P31939	:	1pkx 1pl0

(no "Related Entries Specified in the PDB File" available for 1P4R)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 7)

Sites (7, 7)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 4)

PROSITE Motifs (0, 0)

Exons (16, 32)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (3, 8)

Pfam Domains (0, 0)

Gene Ontology (24, 24)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File