Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SSPB
 
Authors :  H. K. Song, M. J. Eck
Date :  01 Apr 03  (Deposition) - 26 Aug 03  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Rna-Binding Property, Hydrolase Activator (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. K. Song, M. J. Eck
Structural Basis Of Degradation Signal Recognition By Sspb, A Specificity-Enhancing Factor For The Clpxp Proteolytic Machine
Mol. Cell V. 12 75 2003
PubMed-ID: 12887894  |  Reference-DOI: 10.1016/S1097-2765(03)00271-5

(-) Compounds

Molecule 1 - STRINGENT STARVATION PROTEIN B
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentRESIDUES 5-111
    GeneSSPB OR B3228 OR Z4586 OR ECS4101
    Organism ScientificESCHERICHIA COLI
    Organism Taxid83334

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1OX8)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1OX8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1OX8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1OX8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1OX8)

(-) Exons   (0, 0)

(no "Exon" information available for 1OX8)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:107
 aligned with SSPB_ECO57 | P0AFZ4 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:107
                                    14        24        34        44        54        64        74        84        94       104       
           SSPB_ECO57     5 QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD 111
               SCOP domains d1ox8a_ A: Stringent starvation protein B, SspB                                                             SCOP domains
               CATH domains 1ox8A00 A:5-111 Stringent starvation protein B, SspB                                                        CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh...eeeeee........hhhhh...eeeee......eeeee...eeeeeee....eeeeeee...eeeeee.....eee...hhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 1ox8 A   5 QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPmEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTmFEPEAAYD 111
                                    14        24        34        44        54        64        74        84        94       104       
                                                                 43-MSE                                                     103-MSE    

Chain A from PDB  Type:PROTEIN  Length:107
 aligned with SSPB_ECOLI | P0AFZ3 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:107
                                    14        24        34        44        54        64        74        84        94       104       
           SSPB_ECOLI     5 QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD 111
               SCOP domains d1ox8a_ A: Stringent starvation protein B, SspB                                                             SCOP domains
               CATH domains 1ox8A00 A:5-111 Stringent starvation protein B, SspB                                                        CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh...eeeeee........hhhhh...eeeee......eeeee...eeeeeee....eeeeeee...eeeeee.....eee...hhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 1ox8 A   5 QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPmEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTmFEPEAAYD 111
                                    14        24        34        44        54        64        74        84        94       104       
                                                                 43-MSE                                                     103-MSE    

Chain B from PDB  Type:PROTEIN  Length:107
 aligned with SSPB_ECO57 | P0AFZ4 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:107
                                    14        24        34        44        54        64        74        84        94       104       
           SSPB_ECO57     5 QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD 111
               SCOP domains d1ox8b_ B: Stringent starvation protein B, SspB                                                             SCOP domains
               CATH domains 1ox8B00 B:5-111 Stringent starvation protein B, SspB                                                        CATH domains
           Pfam domains (1) SspB-1ox8B01 B:5-111                                                                                        Pfam domains (1)
           Pfam domains (2) SspB-1ox8B02 B:5-111                                                                                        Pfam domains (2)
         Sec.struct. author ....hhhhhhhhhhhhhhhh...eeeeee........hhhhh...eeeee......eeeee...eeeeeeee..eeeeeeee...eeeeee.....eee...hhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 1ox8 B   5 QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPmEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTmFEPEAAYD 111
                                    14        24        34        44        54        64        74        84        94       104       
                                                                 43-MSE                                                     103-MSE    

Chain B from PDB  Type:PROTEIN  Length:107
 aligned with SSPB_ECOLI | P0AFZ3 from UniProtKB/Swiss-Prot  Length:165

    Alignment length:107
                                    14        24        34        44        54        64        74        84        94       104       
           SSPB_ECOLI     5 QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPMEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTMFEPEAAYD 111
               SCOP domains d1ox8b_ B: Stringent starvation protein B, SspB                                                             SCOP domains
               CATH domains 1ox8B00 B:5-111 Stringent starvation protein B, SspB                                                        CATH domains
           Pfam domains (1) SspB-1ox8B01 B:5-111                                                                                        Pfam domains (1)
           Pfam domains (2) SspB-1ox8B02 B:5-111                                                                                        Pfam domains (2)
         Sec.struct. author ....hhhhhhhhhhhhhhhh...eeeeee........hhhhh...eeeee......eeeee...eeeeeeee..eeeeeeee...eeeeee.....eee...hhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 1ox8 B   5 QLTPRRPYLLRAFYEWLLDNQLTPHLVVDVTLPGVQVPmEYARDGQIVLNIAPRAVGNLELANDEVRFNARFGGIPRQVSVPLAAVLAIYARENGAGTmFEPEAAYD 111
                                    14        24        34        44        54        64        74        84        94       104       
                                                                 43-MSE                                                     103-MSE    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (SSPB_ECO57 | P0AFZ4)

Chain A,B   (SSPB_ECOLI | P0AFZ3)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0045732    positive regulation of protein catabolic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of a protein by the destruction of the native, active configuration, with or without the hydrolysis of peptide bonds.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005840    ribosome    An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1ox8)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ox8)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ox8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SSPB_ECO57 | P0AFZ4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SSPB_ECOLI | P0AFZ3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SSPB_ECO57 | P0AFZ4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SSPB_ECOLI | P0AFZ3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SSPB_ECO57 | P0AFZ41ox9
        SSPB_ECOLI | P0AFZ31ox9 1yfn 2ds8

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1OX8)