Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  TROUT HEMOGLOBIN I
 
Authors :  J. Tame, J. Wilson
Date :  21 Jun 96  (Deposition) - 11 Jan 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Heme, Oxygen Transport, Respiratory Protein, Erythrocyte (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. R. Tame, J. C. Wilson, R. E. Weber
The Crystal Structures Of Trout Hb I In The Deoxy And Carbonmonoxy Forms.
J. Mol. Biol. V. 259 749 1996
PubMed-ID: 8683580  |  Reference-DOI: 10.1006/JMBI.1996.0355
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HEMOGLOBIN I
    Chains: A
    Engineered: YES
    Mutation: YES
    Organism Common: RAINBOW TROUT
    Organism Scientific: ONCORHYNCHUS MYKISS
    Organism Taxid: 8022
    Other Details: DEOXY
    Tissue: BLOOD
 
Molecule 2 - HEMOGLOBIN I
    Chains: B
    Engineered: YES
    Mutation: YES
    Organism Common: RAINBOW TROUT
    Organism Scientific: ONCORHYNCHUS MYKISS
    Organism Taxid: 8022
    Other Details: DEOXY

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
1ACE1Mod. Amino AcidACETYL GROUP
2HEM2Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
Biological Unit 1 (2, 6)
No.NameCountTypeFull Name
1ACE2Mod. Amino AcidACETYL GROUP
2HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE A:43 , HIS A:45 , TRP A:46 , HIS A:59 , ILE A:62 , ILE A:63 , ALA A:66 , LEU A:84 , HIS A:88 , LEU A:92 , ASN A:98 , PHE A:99 , LEU A:137BINDING SITE FOR RESIDUE HEM A 143
2AC2SOFTWAREHIS A:45 , ALA A:47 , TYR B:41 , PHE B:42 , HIS B:63 , VAL B:67 , ALA B:70 , THR B:91 , HIS B:92 , LEU B:96 , ASN B:102 , PHE B:103 , LEU B:106 , HOH B:232BINDING SITE FOR RESIDUE HEM B 148

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1OUT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1OUT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1OUT)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GLOBINPS01033 Globin family profile.HBA1_ONCMY2-144  1A:2-142
HBB1_ONCMY4-145  1B:4-145
Biological Unit 1 (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GLOBINPS01033 Globin family profile.HBA1_ONCMY2-144  2A:2-142
HBB1_ONCMY4-145  2B:4-145

(-) Exons   (0, 0)

(no "Exon" information available for 1OUT)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:143
 aligned with HBA1_ONCMY | P02019 from UniProtKB/Swiss-Prot  Length:144

    Alignment length:145
                             1                                                                                                                                               
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139     
           HBA1_ONCMY     - -SLTAKDKSVVKAFWGKISGKADVVGAEALGRDKMLTAYPQTKTYFSHWADLSPGSGPVKKHGGIIMGAIGKAVGLMDDLVGGMSALSDLHAFKLRVDPGNFKILSHNILVTLAIHFPSDFTPEVHIAVDKFLAAVSAALADKYR 144
               SCOP domains d1outa_ A: Hemoglobin, alpha-cha  in                                                                                                              SCOP domains
               CATH domains -1outA00 A:1-142 Globins                                                                                                                          CATH domains
               Pfam domains ------Globin-1outA01 A:6-107    --                                                                            ----------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhhhh--hhhh.hhhhhhh..........hhhhhhhhhhhhhhhhhhh....hhhh.hhhhhhhhh.....hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --GLOBIN  PDB: A:2-142 UniProt: 2-144                                                                                                             PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1out A   0 xSLTAKDKSVVKAFWGKISGKADVVGAEALGR--MLTAYPQTKTYFSHWADLSPGSGPVKKHGGIIMGAIGKAVGLMDDLVGGMSALSDLHAFKLRVDPGNFKILSHNILVTLAIHFPSDFTPEVHIAVDKFLAAVSAALADKYR 142
                            |        9        19        29 |  |   37        47        57        67        77        87        97       107       117       127       137     
                            |                             31 32                                                                                                              
                            0-ACE                                                                                                                                            


Chain B from PDB  Type:PROTEIN  Length:146
 aligned with HBB1_ONCMY | P02142 from UniProtKB/Swiss-Prot  Length:146

    Alignment length:146
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140      
           HBB1_ONCMY     1 VEWTDAEKSTISAVWGKVNIDEIGPLALARVLIVYPWTQRYFGSFGNVSTPAAIMGNPKVAAHGKVVCGALDKAVKNMGNILATYKSLSETHANKLFVDPDNFRVLADVLTIVIAAKFGASFTPEIQATWQKFMKVVVAAMGSRYF 146
               SCOP domains d1outb_ B: Hemoglobin, beta-chain                                                                                                                  SCOP domains
               CATH domains 1outB00 B:1-146 Globins                                                                                                                            CATH domains
               Pfam domains ------Globin-1outB01 B:7-111                                                                                   ----------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhh.hhh.....hhhhhh.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---GLOBIN  PDB: B:4-145 UniProt: 4-145                                                                                                           - PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1out B   1 VEWTDAEKSTISAVWGKVNIDEIGPLALARVLIVYPWTQRYFGSFGNVSTPAAIMGNPKVAAHGKVVCGALDKAVKNMGNILATYKSLSETHANKLFVDPDNFRVLADVLTIVIAAKFGASFTPEIQATWQKFMKVVVAAMGSRYF 146
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: Globin (291)

(-) Gene Ontology  (8, 16)

Asymmetric Unit(hide GO term definitions)
Chain A   (HBA1_ONCMY | P02019)
molecular function
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019825    oxygen binding    Interacting selectively and non-covalently with oxygen (O2).
    GO:0005344    oxygen transporter activity    Enables the directed movement of oxygen into, out of or within a cell, or between cells.
biological process
    GO:0015671    oxygen transport    The directed movement of oxygen (O2) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005833    hemoglobin complex    An iron-containing, oxygen carrying complex. In vertebrates it is made up of two pairs of associated globin polypeptide chains, each chain carrying a noncovalently bound heme prosthetic group.

Chain B   (HBB1_ONCMY | P02142)
molecular function
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0019825    oxygen binding    Interacting selectively and non-covalently with oxygen (O2).
    GO:0005344    oxygen transporter activity    Enables the directed movement of oxygen into, out of or within a cell, or between cells.
biological process
    GO:0015671    oxygen transport    The directed movement of oxygen (O2) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005833    hemoglobin complex    An iron-containing, oxygen carrying complex. In vertebrates it is made up of two pairs of associated globin polypeptide chains, each chain carrying a noncovalently bound heme prosthetic group.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1out)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1out
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HBA1_ONCMY | P02019
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  HBB1_ONCMY | P02142
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HBA1_ONCMY | P02019
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  HBB1_ONCMY | P02142
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HBA1_ONCMY | P02019: 1ouu
        HBB1_ONCMY | P02142: 1ouu

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1OUT)