1OKI - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF TRUNCATED HUMAN BETA-B1-CRYSTALLIN

Authors :   R. L. M. Van Montfort, O. A. Bateman, N. H. Lubsen, C. Slingsby

Date :   25 Jul 03 (Deposition) - 22 Jan 04 (Release) - 05 Nov 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.40

Chains :   Asym./Biol. Unit : A,B

Keywords :   Crystallin, Cataract, Eye Lens Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. L. M. Van Montfort, O. A. Bateman, N. H. Lubsen, C. Slingsby
Crystal Structure Of Truncated Human Beta-B1-Crystallin
Protein Sci. V. 12 2606 2003
PubMed-ID: 14573871 | Reference-DOI: 10.1110/PS.03265903

Molecule 1 - BETA CRYSTALLIN B1
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Variant	:	DE3
	Fragment	:	CRYSTALLIN DOMAINS, RESIDUES 42-251
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Tissue	:	EYE LENS

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	CSD	2	Mod. Amino Acid	3-SULFINOALANINE

(no "Site" information available for 1OKI)

(no "SS Bond" information available for 1OKI)

Asymmetric/Biological Unit

No.	Residues
1	Gly A:98	-	Pro A:99
2	Gly B:98	-	Pro B:99

Asymmetric/Biological Unit (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_070030	V	96	F	CRBB1_HUMAN	Disease (CTRCT17)	---	A/B	V	95	F
2	UniProt	VAR_065296	S	129	R	CRBB1_HUMAN	Disease	---	A/B	S	128	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CRYSTALLIN_BETA_GAMMA	PS50915	Crystallins beta and gamma 'Greek key' motif profile.	CRBB1_HUMAN	59-98 99-143 149-190 191-233	8	A:58-97 B:58-97 A:98-142 B:98-142 A:148-189 B:148-189 A:190-232 B:190-232

Asymmetric/Biological Unit (5, 10)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000215939	1	ENSE00001047857	chr22:27014052-27013941	112	CRBB1_HUMAN	-	0	0	-	-
1.2a	ENST00000215939	2a	ENSE00000879664	chr22:27012302-27012104	199	CRBB1_HUMAN	1-60	60	2	A:54-59 B:54-59	6 6
1.4	ENST00000215939	4	ENSE00000651921	chr22:27008154-27008036	119	CRBB1_HUMAN	61-100	40	2	A:60-99 B:60-99	40 40
1.5	ENST00000215939	5	ENSE00002177077	chr22:27003985-27003853	133	CRBB1_HUMAN	100-144	45	2	A:99-143 B:99-143	45 45
1.6	ENST00000215939	6	ENSE00001773373	chr22:26997985-26997843	143	CRBB1_HUMAN	145-192	48	2	A:144-191 B:144-191	48 48
1.7c	ENST00000215939	7c	ENSE00001784497	chr22:26995637-26995242	396	CRBB1_HUMAN	192-252	61	2	A:191-236 B:191-237	46 47

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:183
 aligned with CRBB1_HUMAN | P53674 from UniProtKB/Swiss-Prot  Length:252

    Alignment length:183
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234   
          CRBB1_HUMAN    55 PPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQW 237
               SCOP domains d1okia1 A:54-144 beta-Crystallin                                                           d1okia2 A:145-236 beta-Crystallin                                                            SCOP domains
               CATH domains 1okiA01 A:54-144 Crystallins                                                               1okiA02 A:145-236 Crystallins                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee...eeeeeee................eeeeee..eeeeeehhheeeeeee..eee.hhhhhh.........eeee........eeeeeeehhheeeeeeee.....hhhhhh......eeeeee.eeeeeee...eeeeeee..eee.hhhhhh.......eeeee..... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------F--------------------------------R------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----CRYSTALLIN_BETA_GAMMA  PDB: A:58-97     CRYSTALLIN_BETA_GAMMA  PDB: A:98-142         -----CRYSTALLIN_BETA_GAMMA  PDB: A:148-189     CRYSTALLIN_BETA_GAMMA  PDB: A:190-232      ---- PROSITE
           Transcript 1 (1) 1.2a  Exon 1.4  PDB: A:60-99 UniProt: 61-100  --------------------------------------------Exon 1.6  PDB: A:144-191 UniProt: 145-192       --------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.5  PDB: A:99-143 UniProt: 100-144     -----------------------------------------------Exon 1.7c  PDB: A:191-236 UniProt: 192-252     Transcript 1 (2)
                 1oki A  54 PPGNYRLVVFELENFQGRRAEFSGEcSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQW 236
                                    63        73     |  83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233   
                                                    79-CSD

Chain B from PDB  Type:PROTEIN  Length:184
 aligned with CRBB1_HUMAN | P53674 from UniProtKB/Swiss-Prot  Length:252

    Alignment length:184
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234    
          CRBB1_HUMAN    55 PPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQWH 238
               SCOP domains d1okib1 B:54-144 beta-Crystallin                                                           d1okib2 B:145-237 beta-Crystallin                                                             SCOP domains
               CATH domains 1okiB01 B:54-144 Crystallins                                                               1okiB02 B:145-237 Crystallins                                                                 CATH domains
           Pfam domains (1) -----------------------------------------------------------------------------------------------Crystall-1okiB01 B:149-231                                                         ------ Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------------------------------------------------Crystall-1okiB02 B:149-231                                                         ------ Pfam domains (2)
           Pfam domains (3) -----------------------------------------------------------------------------------------------Crystall-1okiB03 B:149-231                                                         ------ Pfam domains (3)
           Pfam domains (4) -----------------------------------------------------------------------------------------------Crystall-1okiB04 B:149-231                                                         ------ Pfam domains (4)
         Sec.struct. author .....eeeeeee...eeeeeee................eeeeee..eeeeeehhheeeeeee..eee.hhhhhh.........eeee........eeeeeeehhheeeeeeee.....hhhhhh......eeeeee.eeeeeee...eeeeeee..eee.hhhhhh.......eeeee...... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------F--------------------------------R------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----CRYSTALLIN_BETA_GAMMA  PDB: B:58-97     CRYSTALLIN_BETA_GAMMA  PDB: B:98-142         -----CRYSTALLIN_BETA_GAMMA  PDB: B:148-189     CRYSTALLIN_BETA_GAMMA  PDB: B:190-232      ----- PROSITE
           Transcript 1 (1) 1.2a  Exon 1.4  PDB: B:60-99 UniProt: 61-100  --------------------------------------------Exon 1.6  PDB: B:144-191 UniProt: 145-192       ---------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------Exon 1.5  PDB: B:99-143 UniProt: 100-144     -----------------------------------------------Exon 1.7c  PDB: B:191-237 UniProt: 192-252      Transcript 1 (2)
                 1oki B  54 PPGNYRLVVFELENFQGRRAEFSGEcSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQWH 237
                                    63        73     |  83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233    
                                                    79-CSD

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: gamma-Crystallin-like (65)

Superfamily: gamma-Crystallin-like (65)

Family: Crystallins/Ca-binding development proteins (34)

Protein domain: beta-Crystallin (11)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d1okia1	A:54-144
1b	d1okia2	A:145-236
1c	d1okib1	B:54-144
1d	d1okib2	B:145-237

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Gamma-B Crystallin; domain 1 (45)

Homologous Superfamily: Crystallins (39)

Human (Homo sapiens) (7)

1a	1okiA01	A:54-144
1b	1okiB01	B:54-144
1c	1okiA02	A:145-236
1d	1okiB02	B:145-237

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: gCrystallin (22)

Family: Crystall (21)

Homo sapiens (Human) (8)

1a	Crystall-1okiB01	B:149-231
1b	Crystall-1okiB02	B:149-231
1c	Crystall-1okiB03	B:149-231
1d	Crystall-1okiB04	B:149-231

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (CRBB1_HUMAN | P53674)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005212	structural constituent of eye lens	The action of a molecule that contributes to the structural integrity of the lens of an eye.
biological process
	GO:0007601	visual perception	The series of events required for an organism to receive a visual stimulus, convert it to a molecular signal, and recognize and characterize the signal. Visual stimuli are detected in the form of photons and are processed to form an image.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CSD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 1oki)

	Cis Peptide Bonds
		Gly A:98 - Pro A:99	[ RasMol ]
		Gly B:98 - Pro B:99	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1oki
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CRBB1_HUMAN \| P53674
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	611544
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CRBB1_HUMAN \| P53674
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1OKI)

(no "Related Entries Specified in the PDB File" available for 1OKI)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 4)

PROSITE Motifs (1, 8)

Exons (5, 10)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (3, 3)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File