1OJR - JenaLib

Title :   L-RHAMNULOSE-1-PHOSPHATE ALDOLASE FROM ESCHERICHIA COLI (MUTANT E192A)

Authors :   M. Kroemer, I. Merkel, G. E. Schulz

Date :   15 Jul 03 (Deposition) - 11 Sep 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.35

Chains :   Asym. Unit : A
Biol. Unit 1: A  (4x)

Keywords :   Lyase, Aldolase (Lyase), Class Ii, Zinc Enzyme, C4-Tetramer, Bacterial L-Rhamnose Metabolism, Cleavage Of L-Rhamnulose-1- Phosphate To Dihydroxyacetonephosphate And L-Lactaldehyde (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Kroemer, I. Merkel, G. E. Schulz
Structure And Catalytic Mechanism Of L-Rhamnulose- 1-Phosphate Aldolase.
Biochemistry V. 42 10560 2003
PubMed-ID: 12962479 | Reference-DOI: 10.1021/BI0349266
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 9)

Sites (9, 9)

Asymmetric Unit (9, 9)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HIS A:141 , HIS A:143 , HIS A:212 , 2HA A:1277 , PO4 A:1278 , HOH A:2503	BINDING SITE FOR RESIDUE ZN A1275
2	AC2	SOFTWARE	ASN A:29 , ASN A:32 , SER A:75 , GLY A:76 , THR A:115 , SER A:116 , PO4 A:1278 , HOH A:2497 , HOH A:2498 , HOH A:2499 , HOH A:2500 , HOH A:2501 , HOH A:2502	BINDING SITE FOR RESIDUE PO4 A1276
3	AC3	SOFTWARE	GLY A:31 , ASN A:32 , GLU A:117 , HIS A:141 , HIS A:143 , HIS A:212 , ZN A:1275 , PO4 A:1276 , GOL A:1279 , HOH A:2497 , HOH A:2502 , HOH A:2503	BINDING SITE FOR RESIDUE PO4 A1278
4	AC4	SOFTWARE	ASN A:29 , GLY A:30 , GLY A:31 , ASN A:32 , GLU A:117 , HIS A:141 , HIS A:143 , HIS A:212 , ZN A:1275 , GOL A:1279 , HOH A:2502 , HOH A:2507	BINDING SITE FOR RESIDUE 2HA A1277
5	AC5	SOFTWARE	HIS A:46 , ASP A:47 , PHE A:49 , GLN A:51 , TYR A:55 , HOH A:2524 , HOH A:2525	BINDING SITE FOR RESIDUE DIO A1283
6	AC6	SOFTWARE	ASN A:29 , GLU A:171 , PRO A:188 , PHE A:263 , 2HA A:1277 , PO4 A:1278 , HOH A:2115 , HOH A:2503 , HOH A:2504 , HOH A:2505 , HOH A:2507	BINDING SITE FOR RESIDUE GOL A1279
7	AC7	SOFTWARE	GLY A:76 , LYS A:77 , ASN A:81 , ASP A:222 , GLU A:223 , HOH A:2508	BINDING SITE FOR RESIDUE GOL A1280
8	AC8	SOFTWARE	ARG A:80 , GLN A:83 , HOH A:2075 , HOH A:2510 , HOH A:2511 , HOH A:2514 , HOH A:2517 , HOH A:2518 , HOH A:2519	BINDING SITE FOR RESIDUE GOL A1281
9	AC9	SOFTWARE	LEU A:154 , TYR A:242 , MET A:244 , LYS A:248 , HOH A:2520 , HOH A:2521 , HOH A:2522	BINDING SITE FOR RESIDUE GOL A1282

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:274
 aligned with RHAD_ECOLI | P32169 from UniProtKB/Swiss-Prot  Length:274

    Alignment length:274
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270    
           RHAD_ECOLI     1 MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQQPRYIPLSQPMPLLANTPFIVTGSGKFFRNVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPAHFLSHCERIKATNGKDRVIMHCHATNLIALTYVLENDTAVFTRQLWEGSTECLVVFPDGVGILPWMVPGTDEIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVKVYSMGGMKQTISREELIALGKRFGVTPLASALAL 274
               SCOP domains d1ojra_ A: L-rhamnulose-1-phosphate aldolase                                                                                                                                                                                                                                       SCOP domains
               CATH domains 1ojrA00 A:1-274 L-fuculose-1-phosphate Aldolase                                                                                                                                                                                                                                    CATH domains
               Pfam domains ----------Aldolase_II-1ojrA01 A:11-239                                                                                                                                                                                                         ----------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh.......eeeee.hhhhhhhhhhhh....eeee....hhhhh..eeeee....hhhhh..hhhhheeeeee.....eeeeeee.........hhhhhhhhhhhhhhhh.....eeeee.hhhhhhhh.....hhhhhhhhhhhh..hhhhhh...eee.......hhhhhhhhhhhhh...eeee...eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh...hhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ojr A   1 MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQQPRYIPLSQPMPLLANTPFIVTGSGKFFRNVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPAHFLSHCERIKATNGKDRVIMHCHATNLIALTYVLENDTAVFTRQLWEGSTECLVVFPDGVGILPWMVPGTDAIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVKVYSMGGMKQTISREELIALGKRFGVTPLASALAL 274
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (9, 9)

Asymmetric Unit(hide GO term definitions)

Chain A (RHAD_ECOLI | P32169)

molecular function
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008994	rhamnulose-1-phosphate aldolase activity	Catalysis of the reaction: L-rhamnulose 1-phosphate = glycerone phosphate + (S)-lactaldehyde.
biological process
	GO:0019323	pentose catabolic process	The chemical reactions and pathways resulting in the breakdown of a pentose, any monosaccharide with a chain of five carbon atoms in the molecule.
	GO:0019301	rhamnose catabolic process	The chemical reactions and pathways resulting in the breakdown of rhamnose, the hexose 6-deoxy-L-mannose.
	GO:0019299	rhamnose metabolic process	The chemical reactions and pathways involving rhamnose, the hexose 6-deoxy-L-mannose. Rhamnose occurs commonly as a compound of plant glycosides, in polysaccharides of gums and mucilages, and in bacterial polysaccharides. It is also a component of some plant cell wall polysaccharides and frequently acts as the sugar components of flavonoids.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		2HA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		DIO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ojr)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1ojr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RHAD_ECOLI \| P32169
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	4.1.2.19
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description