Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF FUNGAL LECTIN: SIX-BLADED BETA-PROPELLER FOLD AND NOVEL FUCOSE RECOGNITION MODE FOR ALEURIA AURANTIA LECTIN
 
Authors :  M. Wimmerova, E. Mitchell, J. F. Sanchez, C. Gautier, A. Imberty
Date :  22 Apr 03  (Deposition) - 24 Jul 03  (Release) - 16 Jun 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Sugar-Binding Protein, Lectin, Aal, Fucose, Aleuria Aurantia Lectin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Wimmerova, E. Mitchell, J. F. Sanchez, C. Gautier, A. Imberty
Crystal Structure Of Fungal Lectin: Six-Bladed {Beta}-Propeller Fold And Novel Fucose Recognition Mode For Aleuria Aurantia Lectin
J. Biol. Chem. V. 278 27059 2003
PubMed-ID: 12732625  |  Reference-DOI: 10.1074/JBC.M302642200

(-) Compounds

Molecule 1 - FUCOSE-SPECIFIC LECTIN
    Chains: A, B
    Organism Common: ORANGE PEEL MUSHROOM
    Organism Scientific: ALEURIA AURANTIA
    Organism Taxid: 5188
    Synonym: ALEURIA AURANTIA LECTIN

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 12)

Asymmetric/Biological Unit (2, 12)
No.NameCountTypeFull Name
1FUC4Ligand/IonALPHA-L-FUCOSE
2FUL8Ligand/IonBETA-L-FUCOSE

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREARG A:24 , GLU A:36 , ILE A:76 , TYR A:92 , TRP A:97 , HOH A:2574 , HOH A:2575 , HOH A:2576 , HOH A:2577BINDING SITE FOR RESIDUE FUL A1313
02AC2SOFTWAREARG A:77 , GLU A:89 , GLY A:100 , GLN A:101 , TRP A:149 , TRP A:153 , HOH A:2579 , HOH A:2596BINDING SITE FOR RESIDUE FUL A1314
03AC3SOFTWAREARG A:77 , GLU A:89 , GLY A:100 , GLN A:101 , TRP A:149 , TRP A:153 , HOH A:2596 , GLY B:243BINDING SITE FOR RESIDUE FUC A1318
04AC4SOFTWAREARG A:131 , GLU A:146 , ALA A:157 , LEU A:178 , TRP A:194 , TRP A:199 , HOH A:2582 , HOH A:2583 , HOH A:2584 , HOH A:2585BINDING SITE FOR RESIDUE FUL A1315
05AC5SOFTWAREARG A:179 , GLU A:191 , GLY A:202 , GLY A:203 , PHE A:204 , TYR A:241 , TRP A:245 , HOH A:2586 , HOH A:2587 , HOH A:2589 , HOH A:2590BINDING SITE FOR RESIDUE FUC A1316
06AC6SOFTWAREARG A:226 , GLU A:238 , TRP A:292 , TRP A:298 , HOH A:2591 , HOH A:2592 , HOH A:2593 , HOH A:2595BINDING SITE FOR RESIDUE FUL A1317
07AC7SOFTWAREARG B:24 , GLU B:36 , ILE B:76 , TYR B:92 , TRP B:97 , HOH B:2554 , HOH B:2555 , HOH B:2556 , HOH B:2557BINDING SITE FOR RESIDUE FUL B1313
08AC8SOFTWAREARG B:77 , GLU B:89 , GLN B:101 , TRP B:149 , TRP B:153 , HOH B:2568 , HOH B:2569BINDING SITE FOR RESIDUE FUC B1314
09AC9SOFTWAREARG B:77 , GLU B:89 , VAL B:91 , GLY B:100 , GLN B:101 , TRP B:153 , HOH B:2568 , HOH B:2569 , HOH B:2570BINDING SITE FOR RESIDUE FUL B1318
10BC1SOFTWAREARG B:131 , GLU B:146 , LEU B:178 , TRP B:194 , TRP B:199 , HOH B:2559 , HOH B:2560 , HOH B:2561 , HOH B:2562BINDING SITE FOR RESIDUE FUL B1315
11BC2SOFTWAREGLN A:72 , ARG B:179 , GLU B:191 , GLY B:202 , GLY B:203 , PHE B:204 , TRP B:245 , HOH B:2446 , HOH B:2563 , HOH B:2564 , HOH B:2565BINDING SITE FOR RESIDUE FUC B1316
12BC3SOFTWAREARG B:226 , GLU B:238 , ILE B:274 , TRP B:292 , TRP B:298 , HOH B:2566 , HOH B:2567BINDING SITE FOR RESIDUE FUL B1317

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1OFZ)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Thr A:222 -Pro A:223
2Asn A:273 -Ile A:274
3Gly A:284 -Val A:285
4Thr B:222 -Pro B:223
5Asn B:273 -Ile B:274
6Gly B:284 -Val B:285

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1OFZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1OFZ)

(-) Exons   (0, 0)

(no "Exon" information available for 1OFZ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:312
 aligned with LECF_ALEAU | P18891 from UniProtKB/Swiss-Prot  Length:313

    Alignment length:312
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311  
           LECF_ALEAU     2 PTEFLYTSKIAAISWAATGGRQQRVYFQDLNGKIREAQRGGDNPWTGGSSQNVIGEAKLFSPLAAVTWKSAQGIQIRVYCVNKDNILSEFVYDGSKWITGQLGSVGVKVGSNSKLAALQWGGSESAPPNIRVYYQKSNGSGSSIHEYVWSGKWTAGASFGSTVPGTGIGATAIGPGRLRIYYQATDNKIREHCWDSNSWYVGGFSASASAGVSIAAISWGSTPNIRVYWQKGREELYEAAYGGSWNTPGQIKDASRPTPSLPDTFIAANSSGNIDISVFFQASGVSLQQWQWISGKGWSIGAVVPTGTPAGW 313
               SCOP domains d1ofza_ A: Fucose-specific lectin                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1ofzA00 A:1-312 Diisopropylfluorophosphatase (phosphotriesterase, DFP)                                                                                                                                                                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........eeeeee......eeeeeee....eeeeeeee.....ee.hhh.eeee.......eeeeeee..eeeeeeeee.....eeeeeee...eee.hhhhhh.........eeeee........eeeeee.......eeeeeeee...eeeeeeeeee.....eeeeeee..eeeeeee....eeeeeee....eeeeeeeee.....eeeeeee....eeeeeee.....eeeeee.......eee...............eeeee...eeeeeeee...eeeeeeee...eeee............ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1ofz A   1 PTEFLYTSKIAAISWAATGGRQQRVYFQDLNGKIREAQRGGDNPWTGGSSQNVIGEAKLFSPLAAVTWKSAQGIQIRVYCVNKDNILSEFVYDGSKWITGQLGSVGVKVGSNSKLAALQWGGSESAPPNIRVYYQKSNLSGSSIHEYVWSGKWTAGASFGSTAPGTGIGATAIGPGRLRIYYQATDNKIREHCWDSNSWYVGGFSASASAGVSIAAISWGSTPNIRVYWQKGREELYEAAYGGSWNTPGQIKDASRPTPSLPDTFIAANSSGNIDISVFFQASGVSLQQWQWISGKGWSIGAVVPTGTPAGW 312
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310  


Chain B from PDB  Type:PROTEIN  Length:312
 aligned with LECF_ALEAU | P18891 from UniProtKB/Swiss-Prot  Length:313

    Alignment length:312
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311  
           LECF_ALEAU     2 PTEFLYTSKIAAISWAATGGRQQRVYFQDLNGKIREAQRGGDNPWTGGSSQNVIGEAKLFSPLAAVTWKSAQGIQIRVYCVNKDNILSEFVYDGSKWITGQLGSVGVKVGSNSKLAALQWGGSESAPPNIRVYYQKSNGSGSSIHEYVWSGKWTAGASFGSTVPGTGIGATAIGPGRLRIYYQATDNKIREHCWDSNSWYVGGFSASASAGVSIAAISWGSTPNIRVYWQKGREELYEAAYGGSWNTPGQIKDASRPTPSLPDTFIAANSSGNIDISVFFQASGVSLQQWQWISGKGWSIGAVVPTGTPAGW 313
               SCOP domains d1ofzb_ B: Fucose-specific lectin                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1ofzB00 B:1-312 Diisopropylfluorophosphatase (phosphotriesterase, DFP)                                                                                                                                                                                                                                                   CATH domains
           Pfam domains (1) Fungal_lectin-1ofzB01 B:1-306                                                                                                                                                                                                                                                                                     ------ Pfam domains (1)
           Pfam domains (2) Fungal_lectin-1ofzB02 B:1-306                                                                                                                                                                                                                                                                                     ------ Pfam domains (2)
         Sec.struct. author .........eeeeee......eeeeeee....eeeeeeee.....ee.hhh.eeee.......eeeeeee..eeeeeeeee.....eeeeee....eee.hhhhhh.........eeeee........eeeeee.......eeeeeeee...eeeeeeeeee.....eeeeeee..eeeeeee....eeeeeee....eee....ee.....eeeeeee....eeeeeee.....eeeeee.......eee...............eeeee...eeeeeeee...eeeeeeee...eeee............ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1ofz B   1 PTEFLYTSKIAAISWAATGGRQQRVYFQDLNGKIREAQRGGDNPWTGGSSQNVIGEAKLFSPLAAVTWKSAQGIQIRVYCVNKDNILSEFVYDGSKWITGQLGSVGVKVGSNSKLAALQWGGSESAPPNIRVYYQKSNLSGSSIHEYVWSGKWTAGASFGSTAPGTGIGATAIGPGRLRIYYQATDNKIREHCWDSNSWYVGGFSASASAGVSIAAISWGSTPNIRVYWQKGREELYEAAYGGSWNTPGQIKDASRPTPSLPDTFIAANSSGNIDISVFFQASGVSLQQWQWISGKGWSIGAVVPTGTPAGW 312
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: Fungal_lectin] (1)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (LECF_ALEAU | P18891)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FUC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FUL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:273 - Ile A:274   [ RasMol ]  
    Asn B:273 - Ile B:274   [ RasMol ]  
    Gly A:284 - Val A:285   [ RasMol ]  
    Gly B:284 - Val B:285   [ RasMol ]  
    Thr A:222 - Pro A:223   [ RasMol ]  
    Thr B:222 - Pro B:223   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ofz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LECF_ALEAU | P18891
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  LECF_ALEAU | P18891
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LECF_ALEAU | P18891: 1iub 1iuc

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1OFZ)