|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1OF9) |
Sites (0, 0)| (no "Site" information available for 1OF9) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1OF9) |
SAPs(SNPs)/Variants (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1OF9) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:77 aligned with PFPA_ENTHI | P34095 from UniProtKB/Swiss-Prot Length:98 Alignment length:77 31 41 51 61 71 81 91 PFPA_ENTHI 22 GEILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQLIEDKVDANAICAKIHAC 98 SCOP domains d1of9a_ A: Ameobapore A SCOP domains CATH domains 1of9A00 A:1-77 NK-Lysin CATH domains Pfam domains -SapB_1-1of9A01 A:2-39 ---SapB_2-1of9A02 A:43-77 Pfam domains SAPs(SNPs) -------------------------------------------------F--------------------------- SAPs(SNPs) PROSITE SAP_B PDB: A:1-77 UniProt: 22-98 PROSITE Transcript ----------------------------------------------------------------------------- Transcript 1of9 A 1 GEILCNLCTGLINTLENLLTTKGADKVKDYISSLCNKASGFIATLCTKVLDFGIDKLIQLIEDKVDANAICAKIHAC 77 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (2, 2)| NMR Structure |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (PFPA_ENTHI | P34095)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|