|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (2, 24) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1OD6) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1OD6) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1OD6) |
Exons (0, 0)| (no "Exon" information available for 1OD6) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:155 aligned with COAD_THET8 | Q5SJS9 from UniProtKB/Swiss-Prot Length:160 Alignment length:160 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 COAD_THET8 1 MHVVYPGSFDPLTNGHLDVIQRASRLFEKVTVAVLENPSKRGQYLFSAEERLAIIREATAHLANVEAATFSGLLVDFVRRVGAQAIVKGLRAVSDYEYELQMAHLNRQLYPGLETLFILAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKLGQ 160 SCOP domains d1od6a_ A: Phosphopantetheine adenyly ltransferase SCOP domains CATH domains 1od6A00 A:1-160 Tyrosyl-Transfer RNA Synthetase , subunit E, domain 1 CATH domains Pfam domains ---CTP_transf_2-1od6A01 A:4-135 ------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1od6 A 1 MHVVYPGSFDPLTNGHLDVIQRASRLFEKVTVAVLEN-----QYLFSAEERLAIIREATAHLANVEAATFSGLLVDFVRRVGAQAIVKGLRAVSDYEYELQMAHLNRQLYPGLETLFILAATRYSFVSSTMVKEIARYGGDVSKLVPPATLRALKAKLGQ 160 10 20 30 | - | 50 60 70 80 90 100 110 120 130 140 150 160 37 43
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (9, 9)|
Asymmetric Unit(hide GO term definitions) Chain A (COAD_THET8 | Q5SJS9)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|