Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  LACTATE DEHYDROGENASE FROM PLASMODIUM BERGHEI
 
Authors :  V. J. Winter, R. L. Brady
Date :  05 Feb 03  (Deposition) - 18 Sep 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Lactate Dehydrogenase, Oxidoreductase, Glycolysis, Interconversion Of Pyruvate And Lactate, 3-Layer (Aba) Sandwich (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. J. Winter, A. Cameron, R. Tranter, R. B. Sessions, R. L. Brady
Crystal Structure Of Plasmodium Berghei Lactate Dehydrogenase Indicates The Unique Structural Differences Of These Enzymes Are Shared Across The Plasmodium Genus
Mol. Biochem. Parasitol. V. 131 1 2003
PubMed-ID: 12967707  |  Reference-DOI: 10.1016/S0166-6851(03)00170-1

(-) Compounds

Molecule 1 - L-LACTATE DEHYDROGENASE
    Chains: A, B
    EC Number: 1.1.1.27
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PKK223-3
    Expression System Strain: JM105
    Expression System Taxid: 562
    Organism Scientific: PLASMODIUM BERGHEI
    Organism Taxid: 5821
    Other Details: NICOTINAMIDE-ADENINE-DINUCLEOTIDE COFACTOR, OXAMIC ACID INHIBITOR
    Strain: ANKA

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 6)

Asymmetric Unit (3, 6)
No.NameCountTypeFull Name
1GOL2Ligand/IonGLYCEROL
2NAD2Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
3OXM2Ligand/IonOXAMIC ACID
Biological Unit 1 (3, 12)
No.NameCountTypeFull Name
1GOL4Ligand/IonGLYCEROL
2NAD4Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
3OXM4Ligand/IonOXAMIC ACID

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:27 , GLY A:29 , MET A:30 , ILE A:31 , PHE A:52 , ASP A:53 , ILE A:54 , TYR A:85 , THR A:97 , ALA A:98 , GLY A:99 , PHE A:100 , THR A:101 , ILE A:119 , ILE A:123 , VAL A:138 , ASN A:140 , LEU A:163 , LEU A:167 , HIS A:195 , OXM A:1331BINDING SITE FOR RESIDUE NAD A1330
2AC2SOFTWAREARG A:109 , LEU A:167 , ARG A:171 , HIS A:195 , PRO A:246 , NAD A:1330BINDING SITE FOR RESIDUE OXM A1331
3AC3SOFTWAREGLY B:27 , GLY B:29 , MET B:30 , ILE B:31 , PHE B:52 , ASP B:53 , ILE B:54 , VAL B:55 , TYR B:85 , THR B:97 , ALA B:98 , GLY B:99 , PHE B:100 , THR B:101 , ILE B:119 , VAL B:138 , ASN B:140 , LEU B:163 , LEU B:167 , HIS B:195 , OXM B:1331 , HOH B:2097 , HOH B:2127 , HOH B:2128BINDING SITE FOR RESIDUE NAD B1330
4AC4SOFTWARETRP B:107 , ARG B:109 , ASN B:140 , LEU B:167 , ARG B:171 , HIS B:195 , ALA B:236 , PRO B:246 , NAD B:1330BINDING SITE FOR RESIDUE OXM B1331
5AC5SOFTWARETHR A:169 , LYS A:173 , ASN A:188 , ALA A:189 , VAL A:268 , ILE A:270 , HOH A:2062 , HOH A:2063 , HOH A:2064 , GLY B:209ABINDING SITE FOR RESIDUE GOL A1332
6AC6SOFTWAREGLY A:209A , THR B:169 , LYS B:173 , ASN B:188 , ALA B:189 , VAL B:268 , ILE B:270 , HOH B:2129 , HOH B:2130 , HOH B:2131BINDING SITE FOR RESIDUE GOL B1332

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1OC4)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Asn A:140 -Pro A:141
2Asn B:140 -Pro B:141

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1OC4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1OC4)

(-) Exons   (0, 0)

(no "Exon" information available for 1OC4)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:315
 aligned with LDH_PLABA | Q7SI97 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:315
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311     
           LDH_PLABA      2 APKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI  316
               SCOP domains d1oc4a1 A:18-163 Lactate dehydrogenase                                                                                                               d1oc4a2 A:164-329 Lactate dehydrogenase                                                                                                                                SCOP domains
               CATH domains 1oc4A01 A:18-164 NAD(P)-binding Rossmann-like Domain                                                                                                  1oc4A02 A:165-329 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee..hhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhhh....eeee.hhhhhh...eeee..........hhhhhhhhhhh..hhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee.hhhhhhhhhhhhhhhhhh.hhhhh...ee.......ee.hhhh.....hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh...eeeeeeeeee.hhh.eeeeeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1oc4 A   18 APKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI  329
                                    27     || 38        49        59        69   ||   78  ||    89        99   |||105B       115       125      |134       144       154       164       174       184       194       204    ||210B     ||221 ||    232       242       252       262       272       282||     293     ||304       314       324     
                                          33|          47|                     73A|      81|                103A||||||                       132A|                                                                         209A|||||   216|  223|                                                       283|           299|                            
                                           35           49                      73B       83                 103B|||||                        132B                                                                          209B||||    218   225                                                        285            301                            
                                                                                                              103C||||                                                                                                       209C|||                                                                                                                   
                                                                                                               103D|||                                                                                                        209D||                                                                                                                   
                                                                                                                103E||                                                                                                         210A|                                                                                                                   
                                                                                                                 105A|                                                                                                          210B                                                                                                                   
                                                                                                                  105B                                                                                                                                                                                                                                 


Chain A from PDB  Type:PROTEIN  Length:315
 aligned with LDH_PLABE | P84793 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:315
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311     
           LDH_PLABE      2 APKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI  316
               SCOP domains d1oc4a1 A:18-163 Lactate dehydrogenase                                                                                                               d1oc4a2 A:164-329 Lactate dehydrogenase                                                                                                                                SCOP domains
               CATH domains 1oc4A01 A:18-164 NAD(P)-binding Rossmann-like Domain                                                                                                  1oc4A02 A:165-329 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee..hhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhhh....eeee.hhhhhh...eeee..........hhhhhhhhhhh..hhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee.hhhhhhhhhhhhhhhhhh.hhhhh...ee.......ee.hhhh.....hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh...eeeeeeeeee.hhh.eeeeeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1oc4 A   18 APKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI  329
                                    27     || 38        49        59        69   ||   78  ||    89        99   |||105B       115       125      |134       144       154       164       174       184       194       204    ||210B     ||221 ||    232       242       252       262       272       282||     293     ||304       314       324     
                                          33|          47|                     73A|      81|                103A||||||                       132A|                                                                         209A|||||   216|  223|                                                       283|           299|                            
                                           35           49                      73B       83                 103B|||||                        132B                                                                          209B||||    218   225                                                        285            301                            
                                                                                                              103C||||                                                                                                       209C|||                                                                                                                   
                                                                                                               103D|||                                                                                                        209D||                                                                                                                   
                                                                                                                103E||                                                                                                         210A|                                                                                                                   
                                                                                                                 105A|                                                                                                          210B                                                                                                                   
                                                                                                                  105B                                                                                                                                                                                                                                 


Chain B from PDB  Type:PROTEIN  Length:315
 aligned with LDH_PLABA | Q7SI97 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:315
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311     
           LDH_PLABA      2 APKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI  316
               SCOP domains d1oc4b1 B:18-163 Lactate dehydrogenase                                                                                                               d1oc4b2 B:164-329 Lactate dehydrogenase                                                                                                                                SCOP domains
               CATH domains 1oc4B01 B:18-164 NAD(P)-binding Rossmann-like Domain                                                                                                  1oc4B02 B:165-329 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                           CATH domains
           Pfam domains (1) ---Ldh_1_N-1oc4B03 B:21-163                                                                                                                          -Ldh_1_C-1oc4B01 B:165-327                                                                                                                                          -- Pfam domains (1)
           Pfam domains (2) ---Ldh_1_N-1oc4B04 B:21-163                                                                                                                          -Ldh_1_C-1oc4B02 B:165-327                                                                                                                                          -- Pfam domains (2)
         Sec.struct. author ....eeeee..hhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhh.....eeee.hhhhhh...eeee..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee.hhhhhhhhhhhhhhhhhh.hhhhh...ee.......ee.hhhh.....hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh...eeeeeeeeee.hhh.eeeeeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1oc4 B   18 APKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI  329
                                    27     || 38        49        59        69   ||   78  ||    89        99   |||105B       115       125      |134       144       154       164       174       184       194       204    ||210B     ||221 ||    232       242       252       262       272       282||     293     ||304       314       324     
                                          33|          47|                     73A|      81|                103A||||||                       132A|                                                                         209A|||||   216|  223|                                                       283|           299|                            
                                           35           49                      73B       83                 103B|||||                        132B                                                                          209B||||    218   225                                                        285            301                            
                                                                                                              103C||||                                                                                                       209C|||                                                                                                                   
                                                                                                               103D|||                                                                                                        209D||                                                                                                                   
                                                                                                                103E||                                                                                                         210A|                                                                                                                   
                                                                                                                 105A|                                                                                                          210B                                                                                                                   
                                                                                                                  105B                                                                                                                                                                                                                                 


Chain B from PDB  Type:PROTEIN  Length:315
 aligned with LDH_PLABE | P84793 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:315
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311     
           LDH_PLABE      2 APKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI  316
               SCOP domains d1oc4b1 B:18-163 Lactate dehydrogenase                                                                                                               d1oc4b2 B:164-329 Lactate dehydrogenase                                                                                                                                SCOP domains
               CATH domains 1oc4B01 B:18-164 NAD(P)-binding Rossmann-like Domain                                                                                                  1oc4B02 B:165-329 L-2-Hydroxyisocaproate Dehydrogenase, subunit A, domain 2                                                                                           CATH domains
           Pfam domains (1) ---Ldh_1_N-1oc4B03 B:21-163                                                                                                                          -Ldh_1_C-1oc4B01 B:165-327                                                                                                                                          -- Pfam domains (1)
           Pfam domains (2) ---Ldh_1_N-1oc4B04 B:21-163                                                                                                                          -Ldh_1_C-1oc4B02 B:165-327                                                                                                                                          -- Pfam domains (2)
         Sec.struct. author ....eeeee..hhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhh.....eeee.hhhhhh...eeee..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee.hhhhhhhhhhhhhhhhhh.hhhhh...ee.......ee.hhhh.....hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh...eeeeeeeeee.hhh.eeeeeeeeeeee..eeeee.....hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1oc4 B   18 APKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLKDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKITDQELDAIFDRTINTALEIVNLHASPYVAPAAAIIEMAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLVIGGNGVEQVIELQLNADEKKKFDEAVAETSRMKALI  329
                                    27     || 38        49        59        69   ||   78  ||    89        99   |||105B       115       125      |134       144       154       164       174       184       194       204    ||210B     ||221 ||    232       242       252       262       272       282||     293     ||304       314       324     
                                          33|          47|                     73A|      81|                103A||||||                       132A|                                                                         209A|||||   216|  223|                                                       283|           299|                            
                                           35           49                      73B       83                 103B|||||                        132B                                                                          209B||||    218   225                                                        285            301                            
                                                                                                              103C||||                                                                                                       209C|||                                                                                                                   
                                                                                                               103D|||                                                                                                        209D||                                                                                                                   
                                                                                                                103E||                                                                                                         210A|                                                                                                                   
                                                                                                                 105A|                                                                                                          210B                                                                                                                   
                                                                                                                  105B
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 4)

Asymmetric Unit
(-)
Clan: LDH_C (56)
(-)
Clan: NADP_Rossmann (1239)

(-) Gene Ontology  (10, 17)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (LDH_PLABE | P84793)
molecular function
    GO:0004459    L-lactate dehydrogenase activity    Catalysis of the reaction: (S)-lactate + NAD+ = pyruvate + NADH + H+.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016616    oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0019752    carboxylic acid metabolic process    The chemical reactions and pathways involving carboxylic acids, any organic acid containing one or more carboxyl (COOH) groups or anions (COO-).
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain A,B   (LDH_PLABA | Q7SI97)
molecular function
    GO:0004459    L-lactate dehydrogenase activity    Catalysis of the reaction: (S)-lactate + NAD+ = pyruvate + NADH + H+.
    GO:0051287    NAD binding    Interacting selectively and non-covalently with nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016616    oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0019752    carboxylic acid metabolic process    The chemical reactions and pathways involving carboxylic acids, any organic acid containing one or more carboxyl (COOH) groups or anions (COO-).
    GO:0006096    glycolytic process    The chemical reactions and pathways resulting in the breakdown of a carbohydrate into pyruvate, with the concomitant production of a small amount of ATP and the reduction of NAD(P) to NAD(P)H. Glycolysis begins with the metabolism of a carbohydrate to generate products that can enter the pathway and ends with the production of pyruvate. Pyruvate may be converted to acetyl-coenzyme A, ethanol, lactate, or other small molecules.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0042866    pyruvate biosynthetic process    The chemical reactions and pathways resulting in the formation of pyruvate, 2-oxopropanoate.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OXM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:140 - Pro A:141   [ RasMol ]  
    Asn B:140 - Pro B:141   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1oc4
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LDH_PLABA | Q7SI97
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  LDH_PLABE | P84793
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.27
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  LDH_PLABA | Q7SI97
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  LDH_PLABE | P84793
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1OC4)

(-) Related Entries Specified in the PDB File

1ldg PLASMODIUM FALCIPARUM L-LACTATE DEHYDROGENASE COMPLEXED WITH NADH AND OXAMATE