Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ODORANT-BINDING PROTEIN FROM BOVINE NASAL MUCOSA
 
Authors :  M. Tegoni, C. Cambillau
Date :  14 Jan 96  (Deposition) - 14 Oct 96  (Release) - 17 Nov 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Olfaction, Nose, Transport, Lipocalin, Odorant-Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Tegoni, R. Ramoni, E. Bignetti, S. Spinelli, C. Cambillau
Domain Swapping Creates A Third Putative Combining Site In Bovine Odorant Binding Protein Dimer
Nat. Struct. Biol. V. 3 863 1996
PubMed-ID: 8836103  |  Reference-DOI: 10.1038/NSB1096-863
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ODORANT-BINDING PROTEIN
    Chains: A, B
    Organ: NOSE
    Organism Common: CATTLE
    Organism Scientific: BOS TAURUS
    Organism Taxid: 9913
    Synonym: OBP
    Tissue: RESPIRATORY EPITHELIUM

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 82)

Asymmetric/Biological Unit (1, 82)
No.NameCountTypeFull Name
1UNX82Ligand/IonUNKNOWN ATOM OR ION

(-) Sites  (82, 82)

Asymmetric Unit (82, 82)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREUNX A:162 , UNX A:163 , UNX A:165 , UNX A:166 , UNX A:172 , UNX A:178 , UNX A:179 , UNX A:180 , UNX A:182 , UNX A:183 , UNX A:184 , UNX A:185 , UNX A:186 , UNX A:187 , UNX A:188 , UNX A:190 , UNX A:192 , UNX A:193 , UNX A:201BINDING SITE FOR RESIDUE UNX A 161
02AC2SOFTWAREUNX A:161 , UNX A:163 , UNX A:164 , UNX A:165 , UNX A:166 , UNX A:167 , UNX A:169 , UNX A:171 , UNX A:172 , UNX A:178 , UNX A:179 , UNX A:180 , UNX A:183 , UNX A:184 , UNX A:186 , UNX A:187 , UNX A:188 , UNX A:189 , UNX A:190 , UNX A:192 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:201BINDING SITE FOR RESIDUE UNX A 162
03AC3SOFTWAREPHE A:40 , UNX A:161 , UNX A:162 , UNX A:164 , UNX A:165 , UNX A:167 , UNX A:169 , UNX A:171 , UNX A:172 , UNX A:180 , UNX A:187 , UNX A:188 , UNX A:189 , UNX A:190 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:201BINDING SITE FOR RESIDUE UNX A 163
04AC4SOFTWAREPHE A:40 , UNX A:162 , UNX A:163 , UNX A:165 , UNX A:166 , UNX A:167 , UNX A:169 , UNX A:171 , UNX A:172 , UNX A:173 , UNX A:177 , UNX A:188 , UNX A:189 , UNX A:190 , UNX A:194 , UNX A:195 , UNX A:200 , UNX A:201BINDING SITE FOR RESIDUE UNX A 164
05AC5SOFTWARETHR A:38 , UNX A:161 , UNX A:162 , UNX A:163 , UNX A:164 , UNX A:166 , UNX A:167 , UNX A:171 , UNX A:180 , UNX A:183 , UNX A:187 , UNX A:188 , UNX A:189 , UNX A:190 , UNX A:192 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:201BINDING SITE FOR RESIDUE UNX A 165
06AC6SOFTWAREPHE A:40 , UNX A:161 , UNX A:162 , UNX A:164 , UNX A:165 , UNX A:167 , UNX A:169 , UNX A:171 , UNX A:172 , UNX A:173 , UNX A:180 , UNX A:188 , UNX A:189 , UNX A:190 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:201BINDING SITE FOR RESIDUE UNX A 166
07AC7SOFTWAREUNX A:162 , UNX A:163 , UNX A:164 , UNX A:165 , UNX A:166 , UNX A:169 , UNX A:171 , UNX A:172 , UNX A:173 , UNX A:174 , UNX A:175 , UNX A:177 , UNX A:189 , UNX A:190 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:197 , UNX A:199 , UNX A:200 , UNX A:201BINDING SITE FOR RESIDUE UNX A 167
08AC8SOFTWAREASN A:103 , LEU A:115 , THR A:116 , UNX A:178 , UNX A:179 , UNX A:180 , UNX A:181 , UNX A:182 , UNX A:183 , UNX A:184 , UNX A:185 , UNX A:186 , UNX A:187 , UNX A:192 , UNX A:193BINDING SITE FOR RESIDUE UNX A 168
09AC9SOFTWAREASN A:103 , UNX A:162 , UNX A:163 , UNX A:164 , UNX A:166 , UNX A:167 , UNX A:170 , UNX A:171 , UNX A:173 , UNX A:174 , UNX A:175 , UNX A:176 , UNX A:177 , UNX A:188 , UNX A:190 , UNX A:191 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:197 , UNX A:198 , UNX A:199 , UNX A:200 , UNX A:201BINDING SITE FOR RESIDUE UNX A 169
10BC1SOFTWAREPHE A:54 , ALA A:81 , UNX A:169 , UNX A:173 , UNX A:174 , UNX A:175 , UNX A:177 , UNX A:191 , UNX A:197 , UNX A:198 , UNX A:199 , UNX A:200BINDING SITE FOR RESIDUE UNX A 170
11BC2SOFTWAREUNX A:162 , UNX A:163 , UNX A:164 , UNX A:165 , UNX A:166 , UNX A:167 , UNX A:169 , UNX A:172 , UNX A:173 , UNX A:174 , UNX A:175 , UNX A:177 , UNX A:188 , UNX A:189 , UNX A:190 , UNX A:194 , UNX A:196 , UNX A:197 , UNX A:198 , UNX A:199 , UNX A:200 , UNX A:201BINDING SITE FOR RESIDUE UNX A 171
12BC3SOFTWAREPHE A:36 , THR A:38 , UNX A:161 , UNX A:162 , UNX A:163 , UNX A:164 , UNX A:166 , UNX A:167 , UNX A:171 , UNX A:180 , UNX A:183 , UNX A:187 , UNX A:188 , UNX A:189 , UNX A:190 , UNX A:192 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:201BINDING SITE FOR RESIDUE UNX A 172
13BC4SOFTWAREUNX A:164 , UNX A:166 , UNX A:167 , UNX A:169 , UNX A:170 , UNX A:171 , UNX A:174 , UNX A:175 , UNX A:176 , UNX A:177 , UNX A:189 , UNX A:190 , UNX A:191 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:197 , UNX A:198 , UNX A:199 , UNX A:200 , UNX A:201BINDING SITE FOR RESIDUE UNX A 173
14BC5SOFTWAREALA A:81 , UNX A:167 , UNX A:169 , UNX A:170 , UNX A:171 , UNX A:173 , UNX A:176 , UNX A:177 , UNX A:191 , UNX A:195 , UNX A:197 , UNX A:198 , UNX A:199 , UNX A:200BINDING SITE FOR RESIDUE UNX A 174
15BC6SOFTWAREASN A:87 , UNX A:167 , UNX A:169 , UNX A:170 , UNX A:171 , UNX A:173 , UNX A:176 , UNX A:177 , UNX A:191 , UNX A:195 , UNX A:197 , UNX A:198 , UNX A:199 , UNX A:200BINDING SITE FOR RESIDUE UNX A 175
16BC7SOFTWAREALA A:81 , UNX A:169 , UNX A:173 , UNX A:174 , UNX A:175 , UNX A:177 , UNX A:191 , UNX A:197 , UNX A:198 , UNX A:199 , UNX A:200BINDING SITE FOR RESIDUE UNX A 176
17BC8SOFTWAREUNX A:164 , UNX A:167 , UNX A:169 , UNX A:170 , UNX A:171 , UNX A:173 , UNX A:174 , UNX A:175 , UNX A:176 , UNX A:190 , UNX A:191 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:197 , UNX A:198 , UNX A:199 , UNX A:200 , UNX A:201BINDING SITE FOR RESIDUE UNX A 177
18BC9SOFTWAREUNX A:161 , UNX A:162 , UNX A:168 , UNX A:179 , UNX A:180 , UNX A:181 , UNX A:182 , UNX A:183 , UNX A:184 , UNX A:185 , UNX A:186 , UNX A:187 , UNX A:188 , UNX A:192 , UNX A:193BINDING SITE FOR RESIDUE UNX A 178
19CC1SOFTWAREUNX A:161 , UNX A:162 , UNX A:168 , UNX A:178 , UNX A:180 , UNX A:181 , UNX A:183 , UNX A:186 , UNX A:187 , UNX A:188 , UNX A:192BINDING SITE FOR RESIDUE UNX A 179
20CC2SOFTWAREUNX A:161 , UNX A:162 , UNX A:163 , UNX A:165 , UNX A:166 , UNX A:168 , UNX A:172 , UNX A:178 , UNX A:179 , UNX A:181 , UNX A:182 , UNX A:184 , UNX A:185 , UNX A:186 , UNX A:187 , UNX A:190 , UNX A:192 , UNX A:193 , UNX A:201BINDING SITE FOR RESIDUE UNX A 180
21CC3SOFTWAREILE A:22 , LEU A:115 , THR A:116 , GLY A:117 , UNX A:168 , UNX A:178 , UNX A:179 , UNX A:180 , UNX A:182 , UNX A:183 , UNX A:184 , UNX A:185 , UNX A:186 , UNX A:187 , UNX A:192 , UNX A:193BINDING SITE FOR RESIDUE UNX A 181
22CC4SOFTWAREUNX A:161 , UNX A:168 , UNX A:178 , UNX A:180 , UNX A:181 , UNX A:183 , UNX A:184 , UNX A:186 , UNX A:187 , UNX A:188 , UNX A:192 , UNX A:193BINDING SITE FOR RESIDUE UNX A 182
23CC5SOFTWAREUNX A:161 , UNX A:162 , UNX A:165 , UNX A:168 , UNX A:172 , UNX A:178 , UNX A:179 , UNX A:181 , UNX A:182 , UNX A:184 , UNX A:185 , UNX A:186 , UNX A:187 , UNX A:188 , UNX A:190 , UNX A:193BINDING SITE FOR RESIDUE UNX A 183
24CC6SOFTWAREPHE A:119 , UNX A:161 , UNX A:162 , UNX A:168 , UNX A:178 , UNX A:180 , UNX A:181 , UNX A:182 , UNX A:183 , UNX A:185 , UNX A:186 , UNX A:187 , UNX A:188 , UNX A:192 , UNX A:193BINDING SITE FOR RESIDUE UNX A 184
25CC7SOFTWAREUNX A:161 , UNX A:168 , UNX A:178 , UNX A:180 , UNX A:181 , UNX A:183 , UNX A:184 , UNX A:186 , UNX A:187 , UNX A:188 , UNX A:192 , UNX A:193BINDING SITE FOR RESIDUE UNX A 185
26CC8SOFTWARETHR A:116 , PHE A:119 , UNX A:161 , UNX A:162 , UNX A:168 , UNX A:178 , UNX A:179 , UNX A:180 , UNX A:181 , UNX A:182 , UNX A:183 , UNX A:184 , UNX A:185 , UNX A:187 , UNX A:188 , UNX A:192 , UNX A:193BINDING SITE FOR RESIDUE UNX A 186
27CC9SOFTWAREUNX A:161 , UNX A:162 , UNX A:163 , UNX A:165 , UNX A:168 , UNX A:172 , UNX A:178 , UNX A:179 , UNX A:180 , UNX A:181 , UNX A:182 , UNX A:183 , UNX A:184 , UNX A:185 , UNX A:186 , UNX A:188 , UNX A:190 , UNX A:192 , UNX A:193 , UNX A:201BINDING SITE FOR RESIDUE UNX A 187
28DC1SOFTWAREUNX A:161 , UNX A:162 , UNX A:163 , UNX A:164 , UNX A:165 , UNX A:166 , UNX A:169 , UNX A:171 , UNX A:172 , UNX A:178 , UNX A:179 , UNX A:182 , UNX A:183 , UNX A:184 , UNX A:185 , UNX A:186 , UNX A:187 , UNX A:190 , UNX A:192 , UNX A:193 , UNX A:195 , UNX A:196 , UNX A:201BINDING SITE FOR RESIDUE UNX A 188
29DC2SOFTWARETHR A:38 , UNX A:162 , UNX A:163 , UNX A:164 , UNX A:165 , UNX A:166 , UNX A:167 , UNX A:171 , UNX A:172 , UNX A:173 , UNX A:190 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:201BINDING SITE FOR RESIDUE UNX A 189
30DC3SOFTWAREUNX A:161 , UNX A:162 , UNX A:163 , UNX A:164 , UNX A:165 , UNX A:166 , UNX A:167 , UNX A:169 , UNX A:171 , UNX A:172 , UNX A:173 , UNX A:177 , UNX A:180 , UNX A:183 , UNX A:187 , UNX A:188 , UNX A:189 , UNX A:192 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:197 , UNX A:201BINDING SITE FOR RESIDUE UNX A 190
31DC4SOFTWAREASN A:87 , ASN A:103 , UNX A:169 , UNX A:170 , UNX A:173 , UNX A:174 , UNX A:175 , UNX A:176 , UNX A:177 , UNX A:195 , UNX A:197 , UNX A:198 , UNX A:199 , UNX A:200BINDING SITE FOR RESIDUE UNX A 191
32DC5SOFTWAREUNX A:161 , UNX A:162 , UNX A:165 , UNX A:168 , UNX A:172 , UNX A:178 , UNX A:179 , UNX A:180 , UNX A:181 , UNX A:182 , UNX A:184 , UNX A:185 , UNX A:186 , UNX A:187 , UNX A:188 , UNX A:190 , UNX A:193BINDING SITE FOR RESIDUE UNX A 192
33DC6SOFTWAREASN A:103 , UNX A:161 , UNX A:168 , UNX A:178 , UNX A:180 , UNX A:181 , UNX A:182 , UNX A:183 , UNX A:184 , UNX A:185 , UNX A:186 , UNX A:187 , UNX A:188 , UNX A:192BINDING SITE FOR RESIDUE UNX A 193
34DC7SOFTWAREPHE A:56 , UNX A:162 , UNX A:163 , UNX A:164 , UNX A:165 , UNX A:166 , UNX A:167 , UNX A:169 , UNX A:171 , UNX A:172 , UNX A:173 , UNX A:177 , UNX A:189 , UNX A:190 , UNX A:195 , UNX A:196 , UNX A:199 , UNX A:200 , UNX A:201BINDING SITE FOR RESIDUE UNX A 194
35DC8SOFTWAREUNX A:162 , UNX A:163 , UNX A:164 , UNX A:165 , UNX A:166 , UNX A:167 , UNX A:169 , UNX A:172 , UNX A:173 , UNX A:174 , UNX A:175 , UNX A:177 , UNX A:188 , UNX A:189 , UNX A:190 , UNX A:191 , UNX A:194 , UNX A:196 , UNX A:197 , UNX A:198 , UNX A:199 , UNX A:200 , UNX A:201BINDING SITE FOR RESIDUE UNX A 195
36DC9SOFTWAREUNX A:162 , UNX A:163 , UNX A:165 , UNX A:166 , UNX A:167 , UNX A:169 , UNX A:171 , UNX A:172 , UNX A:173 , UNX A:177 , UNX A:188 , UNX A:189 , UNX A:190 , UNX A:194 , UNX A:195 , UNX A:199 , UNX A:200 , UNX A:201BINDING SITE FOR RESIDUE UNX A 196
37EC1SOFTWAREASN A:87 , ASN A:103 , UNX A:167 , UNX A:169 , UNX A:170 , UNX A:171 , UNX A:173 , UNX A:174 , UNX A:175 , UNX A:176 , UNX A:177 , UNX A:190 , UNX A:191 , UNX A:195 , UNX A:198 , UNX A:199 , UNX A:200 , UNX A:201BINDING SITE FOR RESIDUE UNX A 197
38EC2SOFTWAREPHE A:89 , ASN A:103 , UNX A:169 , UNX A:170 , UNX A:171 , UNX A:173 , UNX A:174 , UNX A:175 , UNX A:176 , UNX A:177 , UNX A:191 , UNX A:195 , UNX A:197 , UNX A:199 , UNX A:200 , UNX A:201BINDING SITE FOR RESIDUE UNX A 198
39EC3SOFTWAREUNX A:167 , UNX A:169 , UNX A:170 , UNX A:171 , UNX A:173 , UNX A:174 , UNX A:175 , UNX A:176 , UNX A:177 , UNX A:191 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:197 , UNX A:198BINDING SITE FOR RESIDUE UNX A 199
40EC4SOFTWAREUNX A:164 , UNX A:167 , UNX A:169 , UNX A:170 , UNX A:171 , UNX A:173 , UNX A:174 , UNX A:175 , UNX A:176 , UNX A:177 , UNX A:191 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:197 , UNX A:198 , UNX A:201BINDING SITE FOR RESIDUE UNX A 200
41EC5SOFTWAREUNX A:161 , UNX A:162 , UNX A:163 , UNX A:164 , UNX A:165 , UNX A:166 , UNX A:167 , UNX A:169 , UNX A:171 , UNX A:172 , UNX A:173 , UNX A:177 , UNX A:180 , UNX A:187 , UNX A:188 , UNX A:189 , UNX A:190 , UNX A:194 , UNX A:195 , UNX A:196 , UNX A:197 , UNX A:198 , UNX A:200BINDING SITE FOR RESIDUE UNX A 201
42EC6SOFTWAREUNX B:162 , UNX B:163 , UNX B:164 , UNX B:165 , UNX B:166 , UNX B:167 , UNX B:177 , UNX B:178 , UNX B:180 , UNX B:181 , UNX B:182 , UNX B:183 , UNX B:184 , UNX B:185 , UNX B:187 , UNX B:189 , UNX B:191 , UNX B:192 , UNX B:200BINDING SITE FOR RESIDUE UNX B 161
43EC7SOFTWARETHR B:38 , UNX B:161 , UNX B:163 , UNX B:164 , UNX B:166 , UNX B:170 , UNX B:171 , UNX B:177 , UNX B:179 , UNX B:182 , UNX B:186 , UNX B:187 , UNX B:188 , UNX B:189 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:200BINDING SITE FOR RESIDUE UNX B 162
44EC8SOFTWAREUNX B:161 , UNX B:162 , UNX B:164 , UNX B:165 , UNX B:168 , UNX B:170 , UNX B:171 , UNX B:176 , UNX B:179 , UNX B:187 , UNX B:188 , UNX B:189 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 163
45EC9SOFTWAREUNX B:161 , UNX B:162 , UNX B:163 , UNX B:165 , UNX B:166 , UNX B:168 , UNX B:170 , UNX B:171 , UNX B:172 , UNX B:176 , UNX B:179 , UNX B:187 , UNX B:188 , UNX B:189 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:196 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 164
46FC1SOFTWARETHR B:38 , UNX B:161 , UNX B:163 , UNX B:164 , UNX B:166 , UNX B:170 , UNX B:171 , UNX B:177 , UNX B:179 , UNX B:182 , UNX B:187 , UNX B:188 , UNX B:189 , UNX B:193 , UNX B:194 , UNX B:195BINDING SITE FOR RESIDUE UNX B 165
47FC2SOFTWAREUNX B:161 , UNX B:162 , UNX B:164 , UNX B:165 , UNX B:168 , UNX B:170 , UNX B:171 , UNX B:172 , UNX B:176 , UNX B:179 , UNX B:187 , UNX B:188 , UNX B:189 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:196 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 166
48FC3SOFTWAREASN B:103 , LEU B:115 , UNX B:161 , UNX B:177 , UNX B:178 , UNX B:179 , UNX B:180 , UNX B:181 , UNX B:182 , UNX B:183 , UNX B:184 , UNX B:185 , UNX B:186 , UNX B:187 , UNX B:191 , UNX B:192BINDING SITE FOR RESIDUE UNX B 167
49FC4SOFTWAREUNX B:163 , UNX B:164 , UNX B:166 , UNX B:169 , UNX B:170 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:175 , UNX B:176 , UNX B:188 , UNX B:189 , UNX B:190 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:197 , UNX B:198 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 168
50FC5SOFTWAREPHE B:54 , ALA B:81 , UNX B:168 , UNX B:170 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:175 , UNX B:176 , UNX B:190 , UNX B:196 , UNX B:197 , UNX B:198 , UNX B:199 , UNX B:201BINDING SITE FOR RESIDUE UNX B 169
51FC6SOFTWAREUNX B:162 , UNX B:163 , UNX B:164 , UNX B:165 , UNX B:166 , UNX B:168 , UNX B:169 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:175 , UNX B:176 , UNX B:188 , UNX B:189 , UNX B:190 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:196 , UNX B:197 , UNX B:198 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 170
52FC7SOFTWAREPHE B:36 , THR B:38 , UNX B:162 , UNX B:163 , UNX B:164 , UNX B:165 , UNX B:166 , UNX B:177 , UNX B:182 , UNX B:187 , UNX B:188 , UNX B:189 , UNX B:191 , UNX B:193 , UNX B:194BINDING SITE FOR RESIDUE UNX B 171
53FC8SOFTWAREUNX B:164 , UNX B:166 , UNX B:168 , UNX B:169 , UNX B:170 , UNX B:173 , UNX B:174 , UNX B:175 , UNX B:176 , UNX B:188 , UNX B:189 , UNX B:190 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:196 , UNX B:197 , UNX B:198 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 172
54FC9SOFTWAREUNX B:168 , UNX B:169 , UNX B:170 , UNX B:172 , UNX B:175 , UNX B:176 , UNX B:190 , UNX B:193 , UNX B:194 , UNX B:196 , UNX B:197 , UNX B:198 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 173
55GC1SOFTWAREUNX B:168 , UNX B:169 , UNX B:170 , UNX B:172 , UNX B:175 , UNX B:176 , UNX B:189 , UNX B:190 , UNX B:193 , UNX B:194 , UNX B:197 , UNX B:198 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 174
56GC2SOFTWAREALA B:81 , UNX B:168 , UNX B:169 , UNX B:170 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:176 , UNX B:190 , UNX B:194 , UNX B:196 , UNX B:197 , UNX B:198 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 175
57GC3SOFTWAREUNX B:163 , UNX B:164 , UNX B:166 , UNX B:168 , UNX B:169 , UNX B:170 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:175 , UNX B:189 , UNX B:190 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:196 , UNX B:197 , UNX B:198 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 176
58GC4SOFTWAREUNX B:161 , UNX B:162 , UNX B:165 , UNX B:167 , UNX B:171 , UNX B:178 , UNX B:179 , UNX B:180 , UNX B:181 , UNX B:182 , UNX B:183 , UNX B:184 , UNX B:185 , UNX B:186 , UNX B:187 , UNX B:191 , UNX B:192BINDING SITE FOR RESIDUE UNX B 177
59GC5SOFTWAREUNX B:161 , UNX B:167 , UNX B:177 , UNX B:179 , UNX B:180 , UNX B:182 , UNX B:183 , UNX B:185 , UNX B:186 , UNX B:187 , UNX B:191 , UNX B:192BINDING SITE FOR RESIDUE UNX B 178
60GC6SOFTWAREUNX B:162 , UNX B:163 , UNX B:164 , UNX B:165 , UNX B:166 , UNX B:167 , UNX B:177 , UNX B:178 , UNX B:180 , UNX B:181 , UNX B:182 , UNX B:183 , UNX B:184 , UNX B:185 , UNX B:186 , UNX B:187 , UNX B:189 , UNX B:191 , UNX B:192 , UNX B:194 , UNX B:200BINDING SITE FOR RESIDUE UNX B 179
61GC7SOFTWARETHR B:116 , GLY B:117 , UNX B:161 , UNX B:167 , UNX B:177 , UNX B:178 , UNX B:179 , UNX B:181 , UNX B:182 , UNX B:183 , UNX B:184 , UNX B:185 , UNX B:186 , UNX B:187 , UNX B:191 , UNX B:192BINDING SITE FOR RESIDUE UNX B 180
62GC8SOFTWAREGLY B:117 , UNX B:161 , UNX B:167 , UNX B:177 , UNX B:179 , UNX B:180 , UNX B:182 , UNX B:183 , UNX B:185 , UNX B:186 , UNX B:187 , UNX B:191 , UNX B:192BINDING SITE FOR RESIDUE UNX B 181
63GC9SOFTWARELEU B:115 , UNX B:161 , UNX B:162 , UNX B:165 , UNX B:167 , UNX B:171 , UNX B:177 , UNX B:178 , UNX B:179 , UNX B:180 , UNX B:181 , UNX B:183 , UNX B:184 , UNX B:185 , UNX B:186 , UNX B:187 , UNX B:192BINDING SITE FOR RESIDUE UNX B 182
64HC1SOFTWAREPHE B:119 , UNX B:161 , UNX B:167 , UNX B:177 , UNX B:178 , UNX B:179 , UNX B:180 , UNX B:181 , UNX B:182 , UNX B:184 , UNX B:187 , UNX B:191 , UNX B:192BINDING SITE FOR RESIDUE UNX B 183
65HC2SOFTWAREGLY B:117 , UNX B:161 , UNX B:167 , UNX B:177 , UNX B:179 , UNX B:180 , UNX B:182 , UNX B:183 , UNX B:185 , UNX B:186 , UNX B:187 , UNX B:191 , UNX B:192BINDING SITE FOR RESIDUE UNX B 184
66HC3SOFTWAREPHE B:119 , UNX B:161 , UNX B:167 , UNX B:177 , UNX B:178 , UNX B:179 , UNX B:180 , UNX B:181 , UNX B:182 , UNX B:184 , UNX B:187 , UNX B:191 , UNX B:192BINDING SITE FOR RESIDUE UNX B 185
67HC4SOFTWAREUNX B:162 , UNX B:167 , UNX B:177 , UNX B:178 , UNX B:179 , UNX B:180 , UNX B:181 , UNX B:182 , UNX B:184 , UNX B:187 , UNX B:191 , UNX B:192 , UNX B:200BINDING SITE FOR RESIDUE UNX B 186
68HC5SOFTWAREUNX B:161 , UNX B:162 , UNX B:163 , UNX B:164 , UNX B:165 , UNX B:166 , UNX B:167 , UNX B:171 , UNX B:177 , UNX B:178 , UNX B:179 , UNX B:180 , UNX B:181 , UNX B:182 , UNX B:183 , UNX B:184 , UNX B:185 , UNX B:186 , UNX B:188 , UNX B:189 , UNX B:191 , UNX B:192 , UNX B:193 , UNX B:194 , UNX B:200BINDING SITE FOR RESIDUE UNX B 187
69HC6SOFTWAREUNX B:162 , UNX B:163 , UNX B:164 , UNX B:165 , UNX B:166 , UNX B:168 , UNX B:170 , UNX B:171 , UNX B:172 , UNX B:187 , UNX B:189 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:200BINDING SITE FOR RESIDUE UNX B 188
70HC7SOFTWAREPHE B:36 , UNX B:161 , UNX B:162 , UNX B:163 , UNX B:164 , UNX B:165 , UNX B:166 , UNX B:168 , UNX B:170 , UNX B:171 , UNX B:172 , UNX B:174 , UNX B:176 , UNX B:179 , UNX B:187 , UNX B:188 , UNX B:191 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:196 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 189
71HC8SOFTWAREASN B:87 , ASN B:103 , UNX B:168 , UNX B:169 , UNX B:170 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:175 , UNX B:176 , UNX B:194 , UNX B:196 , UNX B:198 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 190
72HC9SOFTWAREASN B:103 , LEU B:115 , UNX B:161 , UNX B:167 , UNX B:171 , UNX B:177 , UNX B:178 , UNX B:179 , UNX B:180 , UNX B:181 , UNX B:183 , UNX B:184 , UNX B:185 , UNX B:186 , UNX B:187 , UNX B:189 , UNX B:192BINDING SITE FOR RESIDUE UNX B 191
73IC1SOFTWAREASN B:103 , UNX B:161 , UNX B:167 , UNX B:177 , UNX B:178 , UNX B:179 , UNX B:180 , UNX B:181 , UNX B:182 , UNX B:183 , UNX B:184 , UNX B:185 , UNX B:186 , UNX B:187 , UNX B:191BINDING SITE FOR RESIDUE UNX B 192
74IC2SOFTWAREPHE B:36 , UNX B:162 , UNX B:163 , UNX B:164 , UNX B:165 , UNX B:166 , UNX B:168 , UNX B:170 , UNX B:171 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:176 , UNX B:187 , UNX B:188 , UNX B:189 , UNX B:194 , UNX B:195 , UNX B:196 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 193
75IC3SOFTWAREUNX B:162 , UNX B:163 , UNX B:164 , UNX B:165 , UNX B:166 , UNX B:168 , UNX B:170 , UNX B:171 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:175 , UNX B:176 , UNX B:179 , UNX B:187 , UNX B:188 , UNX B:189 , UNX B:190 , UNX B:193 , UNX B:195 , UNX B:196 , UNX B:197 , UNX B:198 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 194
76IC4SOFTWAREPHE B:56 , UNX B:162 , UNX B:163 , UNX B:164 , UNX B:165 , UNX B:166 , UNX B:168 , UNX B:170 , UNX B:172 , UNX B:176 , UNX B:188 , UNX B:189 , UNX B:193 , UNX B:194 , UNX B:196 , UNX B:198 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 195
77IC5SOFTWAREUNX B:164 , UNX B:166 , UNX B:169 , UNX B:170 , UNX B:172 , UNX B:173 , UNX B:175 , UNX B:176 , UNX B:189 , UNX B:190 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:197 , UNX B:198 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 196
78IC6SOFTWAREASN B:103 , UNX B:168 , UNX B:169 , UNX B:170 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:175 , UNX B:176 , UNX B:194 , UNX B:196 , UNX B:198 , UNX B:199 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 197
79IC7SOFTWAREUNX B:168 , UNX B:169 , UNX B:170 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:175 , UNX B:176 , UNX B:190 , UNX B:194 , UNX B:195 , UNX B:196 , UNX B:197 , UNX B:201BINDING SITE FOR RESIDUE UNX B 198
80IC8SOFTWAREUNX B:164 , UNX B:168 , UNX B:169 , UNX B:170 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:175 , UNX B:176 , UNX B:190 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:196 , UNX B:197 , UNX B:200 , UNX B:201BINDING SITE FOR RESIDUE UNX B 199
81IC9SOFTWAREPHE B:89 , UNX B:161 , UNX B:162 , UNX B:163 , UNX B:164 , UNX B:166 , UNX B:168 , UNX B:170 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:175 , UNX B:176 , UNX B:179 , UNX B:186 , UNX B:187 , UNX B:188 , UNX B:189 , UNX B:190 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:196 , UNX B:197 , UNX B:199 , UNX B:201BINDING SITE FOR RESIDUE UNX B 200
82JC1SOFTWAREPHE B:54 , PHE B:89 , UNX B:163 , UNX B:164 , UNX B:166 , UNX B:168 , UNX B:169 , UNX B:170 , UNX B:172 , UNX B:173 , UNX B:174 , UNX B:175 , UNX B:176 , UNX B:189 , UNX B:190 , UNX B:193 , UNX B:194 , UNX B:195 , UNX B:196 , UNX B:197 , UNX B:198 , UNX B:199 , UNX B:200BINDING SITE FOR RESIDUE UNX B 201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1OBP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1OBP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1OBP)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LIPOCALINPS00213 Lipocalin signature.OBP_BOVIN7-20
 		  2A:7-20
B:7-20

(-) Exons   (0, 0)

(no "Exon" information available for 1OBP)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:158
 aligned with OBP_BOVIN | P07435 from UniProtKB/Swiss-Prot  Length:159

    Alignment length:158
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151        
            OBP_BOVIN     2 QEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE 159
               SCOP domains d1obpa_ A: Odorant-binding protein                                                                                                                             SCOP domains
               CATH domains 1obpA00 A:2-159  [code=2.40.128.20, no name defined]                                                                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhh...eeeeeeee..hhh.........eeeeeeee....eeeeeeeeee..eeeeeeeeee......eeee...eeeeeeeee...eeeeeeeee.....eeeeeeeeee....hhhhhhhhhhhhh....hhheee........... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----LIPOCALIN     ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1obp A   2 QEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTGLFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE 159
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151        


Chain B from PDB  Type:PROTEIN  Length:155
 aligned with OBP_BOVIN | P07435 from UniProtKB/Swiss-Prot  Length:159

    Alignment length:155
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152     
            OBP_BOVIN     3 EEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPH 157
               SCOP domains d1obpb_ B: Odorant-binding protein                                                                                                                          SCOP domains
               CATH domains 1obpB00 B:3-157  [code=2.40.128.20, no name defined]                                                                                                        CATH domains
           Pfam domains (1) -----------Lipocalin-1obpB01 B:14-153                                                                                                                  ---- Pfam domains (1)
           Pfam domains (2) -----------Lipocalin-1obpB02 B:14-153                                                                                                                  ---- Pfam domains (2)
         Sec.struct. author .......hhhh...eeeeeeee..hhhh........eeeeeeee....eeeeeeeeee..eeeeeeeeee......eeee...eeeeeeeee...eeeeeeeee.....eeeeeeeeee....hhhhhhhhhhhhh....hhheeehhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----LIPOCALIN     ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1obp B   3 EEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTGLFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPH 157
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Calycin (163)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (OBP_BOVIN | P07435)
molecular function
    GO:0005549    odorant binding    Interacting selectively and non-covalently with an odorant, any substance capable of stimulating the sense of smell.
    GO:0005215    transporter activity    Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
    GO:0050896    response to stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus. The process begins with detection of the stimulus and ends with a change in state or activity or the cell or organism.
    GO:0007608    sensory perception of smell    The series of events required for an organism to receive an olfactory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Olfaction involves the detection of chemical composition of an organism's ambient medium by chemoreceptors. This is a neurological process.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    UNX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
    BC7  [ RasMol ]  +environment [ RasMol ]
    BC8  [ RasMol ]  +environment [ RasMol ]
    BC9  [ RasMol ]  +environment [ RasMol ]
    CC1  [ RasMol ]  +environment [ RasMol ]
    CC2  [ RasMol ]  +environment [ RasMol ]
    CC3  [ RasMol ]  +environment [ RasMol ]
    CC4  [ RasMol ]  +environment [ RasMol ]
    CC5  [ RasMol ]  +environment [ RasMol ]
    CC6  [ RasMol ]  +environment [ RasMol ]
    CC7  [ RasMol ]  +environment [ RasMol ]
    CC8  [ RasMol ]  +environment [ RasMol ]
    CC9  [ RasMol ]  +environment [ RasMol ]
    DC1  [ RasMol ]  +environment [ RasMol ]
    DC2  [ RasMol ]  +environment [ RasMol ]
    DC3  [ RasMol ]  +environment [ RasMol ]
    DC4  [ RasMol ]  +environment [ RasMol ]
    DC5  [ RasMol ]  +environment [ RasMol ]
    DC6  [ RasMol ]  +environment [ RasMol ]
    DC7  [ RasMol ]  +environment [ RasMol ]
    DC8  [ RasMol ]  +environment [ RasMol ]
    DC9  [ RasMol ]  +environment [ RasMol ]
    EC1  [ RasMol ]  +environment [ RasMol ]
    EC2  [ RasMol ]  +environment [ RasMol ]
    EC3  [ RasMol ]  +environment [ RasMol ]
    EC4  [ RasMol ]  +environment [ RasMol ]
    EC5  [ RasMol ]  +environment [ RasMol ]
    EC6  [ RasMol ]  +environment [ RasMol ]
    EC7  [ RasMol ]  +environment [ RasMol ]
    EC8  [ RasMol ]  +environment [ RasMol ]
    EC9  [ RasMol ]  +environment [ RasMol ]
    FC1  [ RasMol ]  +environment [ RasMol ]
    FC2  [ RasMol ]  +environment [ RasMol ]
    FC3  [ RasMol ]  +environment [ RasMol ]
    FC4  [ RasMol ]  +environment [ RasMol ]
    FC5  [ RasMol ]  +environment [ RasMol ]
    FC6  [ RasMol ]  +environment [ RasMol ]
    FC7  [ RasMol ]  +environment [ RasMol ]
    FC8  [ RasMol ]  +environment [ RasMol ]
    FC9  [ RasMol ]  +environment [ RasMol ]
    GC1  [ RasMol ]  +environment [ RasMol ]
    GC2  [ RasMol ]  +environment [ RasMol ]
    GC3  [ RasMol ]  +environment [ RasMol ]
    GC4  [ RasMol ]  +environment [ RasMol ]
    GC5  [ RasMol ]  +environment [ RasMol ]
    GC6  [ RasMol ]  +environment [ RasMol ]
    GC7  [ RasMol ]  +environment [ RasMol ]
    GC8  [ RasMol ]  +environment [ RasMol ]
    GC9  [ RasMol ]  +environment [ RasMol ]
    HC1  [ RasMol ]  +environment [ RasMol ]
    HC2  [ RasMol ]  +environment [ RasMol ]
    HC3  [ RasMol ]  +environment [ RasMol ]
    HC4  [ RasMol ]  +environment [ RasMol ]
    HC5  [ RasMol ]  +environment [ RasMol ]
    HC6  [ RasMol ]  +environment [ RasMol ]
    HC7  [ RasMol ]  +environment [ RasMol ]
    HC8  [ RasMol ]  +environment [ RasMol ]
    HC9  [ RasMol ]  +environment [ RasMol ]
    IC1  [ RasMol ]  +environment [ RasMol ]
    IC2  [ RasMol ]  +environment [ RasMol ]
    IC3  [ RasMol ]  +environment [ RasMol ]
    IC4  [ RasMol ]  +environment [ RasMol ]
    IC5  [ RasMol ]  +environment [ RasMol ]
    IC6  [ RasMol ]  +environment [ RasMol ]
    IC7  [ RasMol ]  +environment [ RasMol ]
    IC8  [ RasMol ]  +environment [ RasMol ]
    IC9  [ RasMol ]  +environment [ RasMol ]
    JC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1obp)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1obp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  OBP_BOVIN | P07435
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  OBP_BOVIN | P07435
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        OBP_BOVIN | P07435: 1g85 1gt1 1gt3 1gt4 1gt5 1hn2 1pbo 2hlv

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1OBP)