|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric/Biological Unit (3, 3) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1O8V) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1O8V) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1O8V) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1O8V) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:134 aligned with FABP1_ECHGR | Q02970 from UniProtKB/Swiss-Prot Length:133 Alignment length:134 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 FABP1_ECHGR - -MEAFLGTWKMEKSEGFDKIMERLGVDFVTRKMGNLVKPNLIVTDLGGGKYKMRSESTFKTTECSFKLGEKFKEVTPDSREVASLITVENGVMKHEQDDKTKVTYIERVVEGNELKATVKVDEVVCVRTYSKVA 133 SCOP domains d1o8va_ A: Fatty acid-binding protein homolog 1 SCOP domains CATH domains -1o8vA00 A:1-133 [code=2.40.128.20, no name defined] CATH domains Pfam domains -----Lipocalin-1o8vA01 A:5-132 - Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------FABP PDB: A:6-23 -------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript 1o8v A 0 xMEAFLGTWKMEKSEGFDKIMERLGVDFVTRKMGNLVKPNLIVTDLGGGKYKMRSESTFKTTEcSFKLGEKFKEVTPDSREVASLITVENGVMKHEQDDKTKVTYIERVVEGNELKATVKVDEVVCVRTYSKVA 133 | 9 19 29 39 49 59 | 69 79 89 99 109 119 129 | 63-CSO 0-ACE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (FABP1_ECHGR | Q02970)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|