Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TRYPAREDOXIN II FROM C.FASCICULATA SOLVED BY SULPHUR PHASING
 
Authors :  G. A. Leonard, E. Micossi, W. N. Hunter
Date :  21 Nov 02  (Deposition) - 19 Dec 02  (Release) - 05 Jul 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Electron Transport, Tryparedoxin Ii, Sulphur Phasing, Sad, S-Sad (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. Micossi, W. N. Hunter, G. A. Leonard
De Novo Phasing Of Two Crystal Forms Of Tryparedoxin Ii Using The Anomalous Scattering From S Atoms: A Combination Of Small Signal And Medium Resolution Reveals This To Be A General Tool For Solving Protein Crystal Structures
Acta Crystallogr. , Sect. D V. 58 21 2002
PubMed-ID: 11752776  |  Reference-DOI: 10.1107/S0907444901016808

(-) Compounds

Molecule 1 - TRYPAREDOXIN II
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET15B
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Fragment: RESIDUES 14-165
    Organism Scientific: CRITHIDIA FASCICULATA
    Organism Taxid: 5656

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1SO41Ligand/IonSULFATE ION

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:142 , ARG A:144 , THR A:145 , HOH A:2202 , HOH A:2203 , LYS B:21BINDING SITE FOR RESIDUE SO4 A1166

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:56 -A:59
2B:56 -B:59

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Ile A:125 -Pro A:126
2Phe A:156 -Pro A:157
3Ile B:125 -Pro B:126
4Phe B:156 -Pro B:157

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1O81)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1O81)

(-) Exons   (0, 0)

(no "Exon" information available for 1O81)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:152
 aligned with O77093_CRIFA | O77093 from UniProtKB/TrEMBL  Length:165

    Alignment length:152
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163  
         O77093_CRIFA    14 PHMSGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPNVEAKK 165
               SCOP domains d1o81a_ A: Tryparedoxin II                                                                                                                               SCOP domains
               CATH domains 1o81A00 A:14-165 Glutaredoxin                                                                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh.......eee..eeeehhhhhh..eeeeeee...hhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhhhhhhh....ee....hhhhhhhhhhhh......eeeeee.....eee.hhhhhhhhh.........hhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o81 A  14 PHMSGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPNVEAKK 165
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163  


Chain B from PDB  Type:PROTEIN  Length:145
 aligned with O77093_CRIFA | O77093 from UniProtKB/TrEMBL  Length:165

    Alignment length:145
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156     
         O77093_CRIFA    17 SGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPNV 161
               SCOP domains d1o81b_ B: Tryparedoxin II                                                                                                                        SCOP domains
               CATH domains 1o81B00 B:17-161 Glutaredoxin                                                                                                                     CATH domains
           Pfam domains (1) ---------------------------Thioredoxin_8-1o81B01 B:44-138                                                                 ----------------------- Pfam domains (1)
           Pfam domains (2) ---------------------------Thioredoxin_8-1o81B02 B:44-138                                                                 ----------------------- Pfam domains (2)
         Sec.struct. author .hhhhhh....eeee...eeee.......eeeeeee...hhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhhhhhhh....ee....hhhhhhhhhhhh......eeeeee.....eee.hhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o81 B  17 SGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPNV 161
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Thioredoxin (367)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1O81)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ile A:125 - Pro A:126   [ RasMol ]  
    Ile B:125 - Pro B:126   [ RasMol ]  
    Phe A:156 - Pro A:157   [ RasMol ]  
    Phe B:156 - Pro B:157   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1o81
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O77093_CRIFA | O77093
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O77093_CRIFA | O77093
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        O77093_CRIFA | O77093: 1fg4 1i5g 1o6j 1oc8 1oc9

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1O81)