Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF TRANSCRIPTIONAL REGULATOR (TM1171) FROM THERMOTOGA MARITIMA AT 2.30 A RESOLUTION
 
Authors :  Joint Center For Structural Genomics (Jcsg)
Date :  23 Sep 03  (Deposition) - 07 Oct 03  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Tm1171, Transcriptional Regulator, Crp Family, Structural Genomics, Jcsg, Psi, Protein Structure Initiative, Joint Center For Structural Genomics, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Spraggon, D. Pantazatos, H. E. Klock, I. A. Wilson, V. L. Woods, S. A. Lesley
On The Use Of Dxms To Produce More Crystallizable Proteins: Structures Of The T. Maritima Proteins Tm0160 And Tm1171.
Protein Sci. V. 13 3187 2004
PubMed-ID: 15557262  |  Reference-DOI: 10.1110/PS.04939904

(-) Compounds

Molecule 1 - TRANSCRIPTIONAL REGULATOR, CRP FAMILY
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneTM1171
    Organism ScientificTHERMOTOGA MARITIMA
    Organism Taxid2336

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1O5L)

(-) Sites  (0, 0)

(no "Site" information available for 1O5L)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1O5L)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Pro A:58 -Val A:59

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1O5L)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1O5L)

(-) Exons   (0, 0)

(no "Exon" information available for 1O5L)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:129
 aligned with Q9X0Q3_THEMA | Q9X0Q3 from UniProtKB/TrEMBL  Length:201

    Alignment length:129
                                    10        20        30        40        50        60        70        80        90       100       110       120         
         Q9X0Q3_THEMA     1 MDLKKLLPCGKVIVFRKGEIVKHQDDPIEDVLILLEGTLKTEHVSENGKTLEIDEIKPVQIIASGFIFSSEPRFPVNVVAGENSKILSIPKEVFLDLLMKDRELLLFFLKDVSEHFRVVSEKLFFLTTK 129
               SCOP domains d1o5la1 A:1-129 CRP-like transcriptional regulator TM1171, N-terminal domain                                                      SCOP domains
               CATH domains 1o5lA00 A:1-129 Jelly Rolls                                                                                                       CATH domains
               Pfam domains -----------cNMP_binding-1o5lA01 A:12-103                                                               -------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhheeeee....eee.......eeeeeee..eeeeee.....eeeeeee...ee.hhhhh.........eeee...eeeeeeehhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o5l A   1 MDLKKLLPCGKVIVFRKGEIVKHQDDPIEDVLILLEGTLKTEHVSENGKTLEIDEIKPVQIIASGFIFSSEPRFPVNVVAGENSKILSIPKEVFLDLLMKDRELLLFFLKDVSEHFRVVSEKLFFLTTK 129
                                    10        20        30        40        50        60        70        80        90       100       110       120         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

Asymmetric Unit

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q9X0Q3_THEMA | Q9X0Q3)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1o5l)
 
  Sites
(no "Sites" information available for 1o5l)
 
  Cis Peptide Bonds
    Pro A:58 - Val A:59   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1o5l
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9X0Q3_THEMA | Q9X0Q3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9X0Q3_THEMA | Q9X0Q3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1O5L)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1O5L)