Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF O-ACETYLSERINE SULFHYDRYLASE (TM0665) FROM THERMOTOGA MARITIMA AT 1.80 A RESOLUTION
 
Authors :  Joint Center For Structural Genomics (Jcsg)
Date :  20 Aug 03  (Deposition) - 02 Sep 03  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Tm0665, O-Acetylserine Sulfhydrylase, Structural Genomics, Jcsg, Psi, Protein Structure Initiative, Joint Center For Structural Genomics, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Heine, J. M. Canaves, F. Von Delft, L. S. Brinen, X. Dai, A. M. Deacon M. A. Elsliger, S. Eshaghi, R. Floyd, A. Godzik, C. Grittini, S. K. Grzechnik, C. Guda, L. Jaroszewski, C. Karlak, H. E. Klock, E. Koesema, J. S. Kovarik, A. Kreusch, P. Kuhn, S. A. Lesley, D. Mcmullan, T. M. Mcphillips, M. A. Miller, M. D. Miller, A. Morse, K. Moy, J. Ouyang, R. Page, A. Robb, K. Rodrigues, R. Schwarzenbacher, T. L. Selby, G. Spraggon, R. C. Stevens, H. Van Den Bedem, J. Velasquez, J. Vincent, X. Wang, B. West, G. Wolf, K. O. Hodgson, J. Wooley, I. A. Wilson
Crystal Structure Of O-Acetylserine Sulfhydrylase (Tm0665) From Thermotoga Maritima At 1. 8 A Resolution
Proteins V. 56 387 2004
PubMed-ID: 15211522  |  Reference-DOI: 10.1002/PROT.20003

(-) Compounds

Molecule 1 - O-ACETYLSERINE SULFHYDRYLASE
    Chains: A, B, C, D
    EC Number: 2.5.1.47
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: TM0665
    Organism Scientific: THERMOTOGA MARITIMA
    Organism Taxid: 2336

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 8)

Asymmetric/Biological Unit (1, 8)
No.NameCountTypeFull Name
1PO48Ligand/IonPHOSPHATE ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:35 , THR A:60 , SER A:61 , ASN A:63 , MET A:64 , GLN A:132 , HOH A:1490 , HOH A:1503BINDING SITE FOR RESIDUE PO4 A 1401
2AC2SOFTWARELYS A:35 , VAL A:165 , GLY A:166 , THR A:167 , GLY A:168 , GLY A:169 , THR A:170 , HOH A:1409 , HOH A:1421 , HOH A:1446BINDING SITE FOR RESIDUE PO4 A 1402
3AC3SOFTWARELYS B:35 , GLY B:166 , THR B:167 , GLY B:168 , GLY B:169 , THR B:170 , HOH B:1406 , HOH B:1407 , HOH B:1410 , HOH B:1494BINDING SITE FOR RESIDUE PO4 B 1403
4AC4SOFTWARELYS B:35 , THR B:60 , SER B:61 , ASN B:63 , MET B:64 , GLN B:132 , HOH B:1432 , HOH B:1575BINDING SITE FOR RESIDUE PO4 B 1404
5AC5SOFTWARELYS C:35 , VAL C:165 , GLY C:166 , THR C:167 , GLY C:168 , GLY C:169 , THR C:170 , HOH C:1409 , HOH C:1411 , HOH C:1421 , HOH C:1465BINDING SITE FOR RESIDUE PO4 C 1405
6AC6SOFTWARELYS C:35 , SER C:61 , GLY C:62 , ASN C:63 , MET C:64 , GLN C:132 , HOH C:1457 , HOH C:1501BINDING SITE FOR RESIDUE PO4 C 1406
7AC7SOFTWARELYS D:35 , VAL D:165 , GLY D:166 , THR D:167 , GLY D:168 , GLY D:169 , THR D:170 , HOH D:1412 , HOH D:1418 , HOH D:1433 , HOH D:1500BINDING SITE FOR RESIDUE PO4 D 1407
8AC8SOFTWARELYS D:35 , THR D:60 , SER D:61 , ASN D:63 , MET D:64 , GLN D:132 , HOH D:1512 , HOH D:1538BINDING SITE FOR RESIDUE PO4 D 1408

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1O58)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1O58)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1O58)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1O58)

(-) Exons   (0, 0)

(no "Exon" information available for 1O58)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:293
 aligned with Q9WZD3_THEMA | Q9WZD3 from UniProtKB/TrEMBL  Length:291

    Alignment length:293
                              1                                                                                                                                                                                                                                                                                                  
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288   
         Q9WZD3_THEMA     - --MMERLIGSTPIVRLDSIDSRIFLKLEKNNPGGSVKDRPALFMILDAEKRGLLKNGIVEPTSGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAELVLTPGELGMKGAVEKALEISRETGAHMLNQFENPYNVYSHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKGFFGNGVKIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEMARYLAKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSIL 291
               SCOP domains d1o58a_ A: O-acetylserine sulfhydrylase (Cysteine synthase)                                                                                                                                                                                                                                           SCOP domains
               CATH domains --1o58A01 A:1-28,A:146-291    1o58A02 A:29-132  [code=3.40.50.1100, no name defined]                                                  -------------1o58A01 A:1-28,A:146-291  [code=3.40.50.1100, no name defined]                                                                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhh....eee.......eeeee.hhh.....hhhhhhhhhhhhhhh......eeee..hhhhhhhhhhhhhhh..eeeeee...hhhhhhhhhhh..eeeeehhh..hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhh.....eeeee...hhhhhhhhhhhhh...hhheeeeeee............................hhhhh.eeeeehhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh......eeeee..hhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o58 A  -1 HHMMERLIGSTPIVRLDSIDSRIFLKLEKNNPGGSVKDRPALFMILDAEKRGLLKNGIVEPTSGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAELVLTPGELGMKGAVEKALEISRETGAHMLNQFENPYNVYSHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKGFFGNGVKIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEMARYLAKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSIL 291
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288   


Chain B from PDB  Type:PROTEIN  Length:285
 aligned with Q9WZD3_THEMA | Q9WZD3 from UniProtKB/TrEMBL  Length:291

    Alignment length:292
                             1                                                                                                                                                                                                                                                                                                  
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289  
         Q9WZD3_THEMA     - -MMERLIGSTPIVRLDSIDSRIFLKLEKNNPGGSVKDRPALFMILDAEKRGLLKNGIVEPTSGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAELVLTPGELGMKGAVEKALEISRETGAHMLNQFENPYNVYSHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKGFFGNGVKIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEMARYLAKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSIL 291
               SCOP domains d1o58b_ B: O-acetylserine sulfhydrylase (Cysteine synthase)                                                                                                                                                                                                                                          SCOP domains
               CATH domains -1o58B01 B:1-28,B:146-290    1o58B02 B:29-132  [code=3.40.50.1100, no name defined]                                                  -------------1o58B01 B:1-28,B:146-290  [code=3.40.50.1100, no name defined]                                                                                   - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhh....eee.......eeeee.hhh.....hhhhhhhhhhhhhhh......eeee..hhhhhhhhhhhhhhh..eeeeee....hhhhhhhhhh..eeeee-------.hhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhh.....eeeee...hhhhhhhhhhhhh...hhheeeeeee............................hhhhh.eeeeehhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh......eeeee..hhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o58 B   0 HMMERLIGSTPIVRLDSIDSRIFLKLEKNNPGGSVKDRPALFMILDAEKRGLLKNGIVEPTSGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAELVLT-------GAVEKALEISRETGAHMLNQFENPYNVYSHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKGFFGNGVKIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEMARYLAKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSIL 291
                                     9        19        29        39        49        59        69        79        89        99     |   -   |   119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289  
                                                                                                                                   105     113                                                                                                                                                                                  


Chain C from PDB  Type:PROTEIN  Length:266
 aligned with Q9WZD3_THEMA | Q9WZD3 from UniProtKB/TrEMBL  Length:291

    Alignment length:291
                             1                                                                                                                                                                                                                                                                                                 
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289 
         Q9WZD3_THEMA     - -MMERLIGSTPIVRLDSIDSRIFLKLEKNNPGGSVKDRPALFMILDAEKRGLLKNGIVEPTSGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAELVLTPGELGMKGAVEKALEISRETGAHMLNQFENPYNVYSHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKGFFGNGVKIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEMARYLAKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSI 290
               SCOP domains d1o58c_ C: O-acetylserine sulfhydrylase (Cysteine synthase)                                                                                                                                                                                                                                         SCOP domains
               CATH domains -1o58C01 C:1-28,C:146-289    1o58C02 C:29-132  [code=3.40.50.1100, no name defined]                                                  -------------1o58C01 C:1-28,C:146-289  [code=3.40.50.1100, no name defined]                                                                                  - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhh....eee.......eeeee.hhh.....hhhhhhhhhhhhhhh......eeee..hhhhhhhhhhhhhhh..eeee.....hhhhhhhhhhh...-------------------------........hhhhhhhhhhhhhhhhhhhh.....eeeee...hhhhhhhhhhhhh...hhheeeeeee............................hhhhh.eeeeehhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh....eeeee..hhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o58 C   0 HMMERLIGSTPIVRLDSIDSRIFLKLEKNNPGGSVKDRPALFMILDAEKRGLLKNGIVEPTSGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAE-------------------------AHMLNQFENPYNVYSHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKGFFGNGVKIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEMARYLAKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSI 290
                                     9        19        29        39        49        59        69        79        89        99 |       -         -       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289 
                                                                                                                               101                       127                                                                                                                                                                   


Chain D from PDB  Type:PROTEIN  Length:279
 aligned with Q9WZD3_THEMA | Q9WZD3 from UniProtKB/TrEMBL  Length:291

    Alignment length:293
                              1                                                                                                                                                                                                                                                                                                  
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288   
         Q9WZD3_THEMA     - --MMERLIGSTPIVRLDSIDSRIFLKLEKNNPGGSVKDRPALFMILDAEKRGLLKNGIVEPTSGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAELVLTPGELGMKGAVEKALEISRETGAHMLNQFENPYNVYSHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKGFFGNGVKIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEMARYLAKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSIL 291
               SCOP domains d1o58d_ D: O-acetylserine sulfhydrylase (Cysteine synthase)                                                                                                                                                                                                                                           SCOP domains
               CATH domains -1o58D01 D:0-28,D:146-290     1o58D02 D:29-132  [code=3.40.50.1100, no name defined]                                                  -------------1o58D01 D:0-28,D:146-290  [code=3.40.50.1100, no name defined]                                                                                   - CATH domains
           Pfam domains (1) ---PALP-1o58D01 D:2-282                                                                                                                                                                                                                                                                     --------- Pfam domains (1)
           Pfam domains (2) ---PALP-1o58D02 D:2-282                                                                                                                                                                                                                                                                     --------- Pfam domains (2)
           Pfam domains (3) ---PALP-1o58D03 D:2-282                                                                                                                                                                                                                                                                     --------- Pfam domains (3)
           Pfam domains (4) ---PALP-1o58D04 D:2-282                                                                                                                                                                                                                                                                     --------- Pfam domains (4)
         Sec.struct. author .hhhhhhh....eee.......eeeee.hhh.....hhhhhhhhhhhhhhh......eeee..hhhhhhhhhhhhhhh..eeee......hhhhhhhhhh..eee--------------hhhhhhhhh........hhhhhhhhhhhhhhhhhhhh.....eeeee...hhhhhhhhhhhhh...hhheeeeeee............................hhhhh.eeeeehhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh......eeeee..hhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o58 D  -1 HHMMERLIGSTPIVRLDSIDSRIFLKLEKNNPGGSVKDRPALFMILDAEKRGLLKNGIVEPTSGNMGIAIAMIGAKRGHRVILTMPETMSVERRKVLKMLGAELV--------------ALEISRETGAHMLNQFENPYNVYSHQFTTGPEILKQMDYQIDAFVAGVGTGGTISGVGRVLKGFFGNGVKIVAVEPAKSPVLSGGQPGKHAIQGIGAGFVPKILDRSVIDEVITVEDEEAYEMARYLAKKEGLLVGISSGANVAAALKVAQKLGPDARVVTVAPDHAERYLSIL 291
                                     8        18        28        38        48        58        68        78        88        98    |    -       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288   
                                                                                                                                  103            118
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 8)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Architecture: 3-Layer(aba) Sandwich (12045)
(-)
Topology: Rossmann fold (7312)
(-)
Homologous Superfamily: [code=3.40.50.1100, no name defined] (77)
(-)
Thermotoga maritima. Organism_taxid: 2336. (1)
1a1o58C01C:1-28,C:146-289
1b1o58B01B:1-28,B:146-290
1c1o58A01A:1-28,A:146-291
1d1o58D01D:0-28,D:146-290
1e1o58A02A:29-132
1f1o58B02B:29-132
1g1o58D02D:29-132
1h1o58C02C:29-132

(-) Pfam Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: PALP] (67)
(-)
Family: PALP (67)
(-)
Thermotoga maritima (1)
1aPALP-1o58D01D:2-282
1bPALP-1o58D02D:2-282
1cPALP-1o58D03D:2-282
1dPALP-1o58D04D:2-282

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (Q9WZD3_THEMA | Q9WZD3)
molecular function
    GO:0080146    L-cysteine desulfhydrase activity    Catalysis of the reaction: L-cysteine + H2O = ammonia + pyruvate + hydrogen sulfide + H+.
    GO:0004124    cysteine synthase activity    Catalysis of the reaction: O3-acetyl-L-serine + hydrogen sulfide = L-cysteine + acetate.
    GO:0030170    pyridoxal phosphate binding    Interacting selectively and non-covalently with pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0019344    cysteine biosynthetic process    The chemical reactions and pathways resulting in the formation of cysteine, 2-amino-3-mercaptopropanoic acid.
    GO:0006535    cysteine biosynthetic process from serine    The chemical reactions and pathways resulting in the formation of cysteine from other compounds, including serine.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1o58)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1o58
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9WZD3_THEMA | Q9WZD3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.47
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9WZD3_THEMA | Q9WZD3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1O58)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1O58)