Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A CBS DOMAIN-CONTAINING PROTEIN (TM0935) FROM THERMOTOGA MARITIMA AT 1.87 A RESOLUTION
 
Authors :  Joint Center For Structural Genomics (Jcsg)
Date :  31 Jul 03  (Deposition) - 12 Aug 03  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.87
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Cbs-Domain Pair Fold, Structural Genomics, Joint Center For Structural Genomics, Jcsg, Protein Structure Initiative, Psi, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. D. Miller, R. Schwarzenbacher, F. Von Delft, P. Abdubek, E. Ambing T. Biorac, L. S. Brinen, J. M. Canaves, J. Cambell, H. J. Chiu, X. Dai, A. M. Deacon, M. Didonato, M. A. Elsliger, S. Eshagi, R. Floyd, A. Godzik, C. Grittini, S. K. Grzechnik, E. Hampton, L. Jaroszewski, C. Karlak, H. E. Klock, E. Koesema, J. S. Kovarik, A. Kreusch, P. Kuhn, S. A. Lesley, I. Levin, D. Mcmullan, T. M. Mcphillips, A. Morse, K. Moy, J. Ouyang, R. Page, K. Quijano, A. Robb, G. Spraggon, R. C. Stevens, H. Van Den Bedem, J. Velasquez, J. Vincent, X. Wang, B. West, G. Wolf, Q. Xu, K. O. Hodgson, J. Wooley, I. A. Wilson
Crystal Structure Of A Tandem Cystathionine-Beta-Synthase (Cbs) Domain Protein (Tm0935) From Thermotoga Maritima At 1. 87 A Resolution
Proteins V. 57 213 2004
PubMed-ID: 15326606  |  Reference-DOI: 10.1002/PROT.20024

(-) Compounds

Molecule 1 - CBS DOMAIN-CONTAINING PREDICTED PROTEIN TM0935
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: TM0935
    Organism Scientific: THERMOTOGA MARITIMA
    Organism Taxid: 2336

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1O50)

(-) Sites  (0, 0)

(no "Site" information available for 1O50)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1O50)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1O50)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1O50)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1O50)

(-) Exons   (0, 0)

(no "Exon" information available for 1O50)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:141
 aligned with Q9X033_THEMA | Q9X033 from UniProtKB/TrEMBL  Length:145

    Alignment length:148
                               1                                                                                                                                                
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137        
         Q9X033_THEMA     - ---MKVKDVCKLISLKPTVVEEDTPIEEIVDRILEDPVTRTVYVARDNKLVGMIPVMHLLKVSGFHFFGFIPKEELIRSSMKRLIAKNASEIMLDPVYVHMDTPLEEALKLMIDNNIQEMPVVDEKGEIVGDLNSLEILLALWKGREK 145
               SCOP domains ---d1o50a3 A:1-145 Hypothetical protein TM0935                                                                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----------------------------------------------------------------------------------------CBS-1o50A01 A:86-141                                    ---- Pfam domains (1)
           Pfam domains (2) ----------------------------------------------------------------------------------------CBS-1o50A02 A:86-141                                    ---- Pfam domains (2)
         Sec.struct. author ....hhhhhh.......eee....hhhhhhhhhhhh....eeeeee..eeeeeeehhhhhhhhhhhhhh...-------........hhhhhh..........hhhhhhhhhhhhh..eeeee.....eeeeeehhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o50 A  -2 HHHMKVKDVCKLISLKPTVVEEDTPIEEIVDRILEDPVTRTVYVARDNKLVGMIPVMHLLKVSGFHFFGFIP-------SMKRLIAKNASEIMLDPVYVHMDTPLEEALKLMIDNNIQEMPVVDEKGEIVGDLNSLEILLALWKGREK 145
                                     7        17        27        37        47        57        67 |      77        87        97       107       117       127       137        
                                                                                                  69      77
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1O50)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: no clan defined [family: CBS] (51)
(-)
Family: CBS (51)
(-)
Thermotoga maritima (3)
1aCBS-1o50A01A:86-141
1bCBS-1o50A02A:86-141

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q9X033_THEMA | Q9X033)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1o50)
 
  Sites
(no "Sites" information available for 1o50)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1o50)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1o50
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9X033_THEMA | Q9X033
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9X033_THEMA | Q9X033
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1O50)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1O50)