Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  X-RAY CRYSTAL STRUCTURE OF PROTEIN YGGJ_HAEIN OF HAEMOPHILUS INFLUENZAE. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET IR73.
 
Authors :  F. Forouhar, J. Shen, R. Xiao, T. B. Acton, B. Rost, G. T. Montelione, L. Tong, Northeast Structural Genomics Consortium (Nesg)
Date :  11 Feb 03  (Deposition) - 11 Mar 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Dimer, Psi, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. Forouhar, J. Shen, R. Xiao, T. B. Acton, G. T. Montelione, L. Tong
Functional Assignment Based On Structural Analysis: Crystal Structure Of The Yggj Protein (Hi0303) Of Haemophilus Influenzae Reveals An Rna Methyltransferase With A Deep Trefoil Knot.
Proteins V. 53 329 2003
PubMed-ID: 14517985  |  Reference-DOI: 10.1002/PROT.10510
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN HI0303
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneHI0303
    Organism ScientificHAEMOPHILUS INFLUENZAE
    Organism Taxid727

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 8)

Asymmetric/Biological Unit (1, 8)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1NXZ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1NXZ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1NXZ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1NXZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1NXZ)

(-) Exons   (0, 0)

(no "Exon" information available for 1NXZ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:246
 aligned with RSME_HAEIN | P44627 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:246
                                                                                                                                                                                                                                                                             245  
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241   |  
           RSME_HAEIN     2 RIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKLDAERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAISALQICFGDLGE--   -
               SCOP domains d1nxza1 A:2-73 Hypothetical protein HI0303                              d1nxza2 A:74-247 Hypothetical protein HI0303                                                                                                                                   SCOP domains
               CATH domains 1nxzA01 A:2-73 Hypothetical PUA domain-like; domain 1                   1nxzA02 A:74-247  [code=3.40.1280.10, no name defined]                                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eee.........eee.hhhhhhhhhh........eeeee....eeeeeeeeeee..eeeeee...ee........eeeeee.....hhhhhhhhhhhh...eeeeee........hhhhhhhhhhhhhhhhhhhhhhhh.....ee...eehhhhhhh....eeeee......hhhhh.......eeeee......hhhhhhhhhhh..eee.......hhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1nxz A   2 RIPRIYHPISLENQTQCYLSEDAANHVARVLRmTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVISRGERmEFTIQKSVELGVNVITPLWSERCGVKLDAERmDKKIQQWQKIAIAACEQCGRNIVPEIRPLmKLQDWCAENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAISALQICFGDLGEAA 247
                                    11        21        31  |     41        51        61        71        81        91|      101       111       121  |    131       141       151  |    161       171       181       191       201       211       221       231       241      
                                                           34-MSE                                                    92-MSE                         124-MSE                       154-MSE                                                                                         

Chain B from PDB  Type:PROTEIN  Length:245
 aligned with RSME_HAEIN | P44627 from UniProtKB/Swiss-Prot  Length:245

    Alignment length:245
                                                                                                                                                                                                                                                                             245 
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241   | 
           RSME_HAEIN     2 RIPRIYHPISLENQTQCYLSEDAANHVARVLRMTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGVNVITPLWSERCGVKLDAERMDKKIQQWQKIAIAACEQCGRNIVPEIRPLMKLQDWCAENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAISALQICFGDLGE-   -
               SCOP domains d1nxzb1 B:2-73 Hypothetical protein HI0303                              d1nxzb2 B:74-246 Hypothetical protein HI0303                                                                                                                                  SCOP domains
               CATH domains 1nxzB01 B:2-73 Hypothetical PUA domain-like; domain 1                   1nxzB02 B:74-246  [code=3.40.1280.10, no name defined]                                                                                                                        CATH domains
           Pfam domains (1) ----------------Methyltrans_RNA-1nxzB01 B:18-238                                                                                                                                                                                             -------- Pfam domains (1)
           Pfam domains (2) ----------------Methyltrans_RNA-1nxzB02 B:18-238                                                                                                                                                                                             -------- Pfam domains (2)
         Sec.struct. author ...eee.........eee.hhhhhhhhhhh.......eeeee....eeeeeeeeee....eeeee...ee........eeeeee.....hhhhhhhhhhhh...eeeeee........hhhhhhhhhhhhhhhhhhhhhhhh.....ee...eehhhhhh.....eeeee.....ee.hhh.......eeeee........hhhhhhhhh..eeee......hhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1nxz B   2 RIPRIYHPISLENQTQCYLSEDAANHVARVLRmTEGEQLELFDGSNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVISRGERmEFTIQKSVELGVNVITPLWSERCGVKLDAERmDKKIQQWQKIAIAACEQCGRNIVPEIRPLmKLQDWCAENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAISALQICFGDLGEA 246
                                    11        21        31  |     41        51        61        71        81        91|      101       111       121  |    131       141       151  |    161       171       181       191       201       211       221       231       241     
                                                           34-MSE                                                    92-MSE                         124-MSE                       154-MSE                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: SPOUT (28)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (RSME_HAEIN | P44627)
molecular function
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0070042    rRNA (uridine-N3-)-methyltransferase activity    Catalysis of the reaction: S-adenosyl-L-methionine + rRNA = S-adenosyl-L-homocysteine + rRNA containing N3-methyluridine.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
    GO:0070475    rRNA base methylation    The addition of a methyl group to an atom in the nucleoside base portion of a nucleotide residue in an rRNA molecule.
    GO:0006364    rRNA processing    Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1nxz)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1nxz)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1nxz
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RSME_HAEIN | P44627
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RSME_HAEIN | P44627
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RSME_HAEIN | P446271vhy

(-) Related Entries Specified in the PDB File

ir73