|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 4)
Asymmetric Unit (1, 4)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1NX2) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1NX2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1NX2) |
PROSITE Motifs (2, 5)| Asymmetric Unit (2, 5) Biological Unit 1 (2, 10) |
Exons (0, 0)| (no "Exon" information available for 1NX2) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:173 aligned with CPNS1_PIG | P04574 from UniProtKB/Swiss-Prot Length:266 Alignment length:173 103 113 123 133 143 153 163 173 183 193 203 213 223 233 243 253 263 CPNS1_PIG 94 EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS 266 SCOP domains d1nx2a_ A: Calpain small (regulatory) subunit (domain VI) SCOP domains CATH domains 1nx2A00 A:94-266 EF-hand CATH domains Pfam domains ---------------EF_hand_6-1nx2A02 A:109-168 --EF_hand_4-1nx2A01 A:171-201 ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --------------------------------------------------------EF_HAND_1 -----------------EF_HAND_1 ---------------------------------------EF_HAND_2 PDB: A:232-266 PROSITE (1) PROSITE (2) -------------------------------------------EF_HAND_2 PDB: A:137-165 -EF_HAND_2 PDB: A:167-202 ---------------------------------------------------------------- PROSITE (2) Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1nx2 A 94 EEVRQFRRLFAQLAGDDMEVSATELMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKQFDVDRSGTIGSSELPGAFEAAGFHLNEHLYSMIIRRYSDEGGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQLTMYS 266 103 113 123 133 143 153 163 173 183 193 203 213 223 233 243 253 263
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (2, 2)
Asymmetric Unit
|
Gene Ontology (9, 9)|
Asymmetric Unit(hide GO term definitions) Chain A (CPNS1_PIG | P04574)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|