1NUL - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   XPRTASE FROM E. COLI

Authors :   S. Vos, J. De Jersey, J. L. Martin

Date :   15 Oct 96 (Deposition) - 15 May 97 (Release) - 16 Nov 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)

Keywords :   Phosphoribosyltransferase, Transferase, Purine Salvage Enzyme (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Vos, J. De Jersey, J. L. Martin
Crystal Structure Of Escherichia Coli Xanthine Phosphoribosyltransferase.
Biochemistry V. 36 4125 1997
PubMed-ID: 9100006 | Reference-DOI: 10.1021/BI962640D
(for further references see the PDB file header)

Molecule 1 - XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
	Chains	:	A, B
	EC Number	:	2.4.2.22
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562
	Synonym	:	XPRT

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 4)

No.	Name	Count	Type	Full Name
1	MG	2	Ligand/Ion	MAGNESIUM ION
2	SO4	2	Ligand/Ion	SULFATE ION

Biological Unit 1 (1, 4)

No.	Name	Count	Type	Full Name
1	MG	-1	Ligand/Ion	MAGNESIUM ION
2	SO4	4	Ligand/Ion	SULFATE ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:53 , SER B:36 , ARG B:37 , GLY B:38 , LYS B:106 , HOH B:762 , HOH B:795	BINDING SITE FOR RESIDUE SO4 B 301
2	AC2	SOFTWARE	ARG A:37 , GLY A:38 , HOH A:735 , HOH A:777 , HOH A:866 , HOH A:960	BINDING SITE FOR RESIDUE SO4 A 302
3	AC3	SOFTWARE	ASP B:89 , HOH B:955 , HOH B:956 , HOH B:957 , HOH B:958 , HOH B:959	BINDING SITE FOR RESIDUE MG B 501
4	AC4	SOFTWARE	ASP A:88 , ASP A:89 , HOH A:960 , HOH A:961 , HOH A:962 , HOH A:963 , HOH A:964	BINDING SITE FOR RESIDUE MG A 502

(no "SS Bond" information available for 1NUL)

Asymmetric Unit

No.	Residues
1	Met A:24	-	Pro A:25
2	Ser A:36	-	Arg A:37
3	Met B:24	-	Pro B:25
4	Ser B:36	-	Arg B:37

(no "SAP(SNP)/Variant" information available for 1NUL)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PUR_PYR_PR_TRANSFER	PS00103	Purine/pyrimidine phosphoribosyl transferases signature.	XGPT_ECOLI	84-96	2	A:84-96 B:84-96

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PUR_PYR_PR_TRANSFER	PS00103	Purine/pyrimidine phosphoribosyl transferases signature.	XGPT_ECOLI	84-96	4	A:84-96 B:84-96

(no "Exon" information available for 1NUL)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:142
 aligned with XGPT_ECOLI | P0A9M5 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:150
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152
           XGPT_ECOLI     3 EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR 152
               SCOP domains d1nula_ A: Xanthine-guanine PRTase (XPRTase)                                                                                                           SCOP domains
               CATH domains 1nulA00 A:3-152  [code=3.40.50.2020, no name defined]                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eee..hhhhhhhhhhhhhhh..hhh..eeeeee.hhhhhhhhhhhhh....eeeee...--------.............eeeee........hhhhhhh....eeee.eeehhhhhh.....eee....eee.hhh............ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------PUR_PYR_PR_TR-------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1nul A   3 EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISS--------LKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR 152
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152
                                                                                      62       71

Chain B from PDB  Type:PROTEIN  Length:136
 aligned with XGPT_ECOLI | P0A9M5 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:150
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152
           XGPT_ECOLI     3 EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR 152
               SCOP domains d1nulb_ B: Xanthine-guanine PRTase (XPRTase)                                                                                                           SCOP domains
               CATH domains 1nulB00 B:3-152  [code=3.40.50.2020, no name defined]                                                                                                  CATH domains
           Pfam domains (1) Pribosyltran-1nulB01 B:3-112                                                                                  ---------------------------------------- Pfam domains (1)
           Pfam domains (2) Pribosyltran-1nulB02 B:3-112                                                                                  ---------------------------------------- Pfam domains (2)
         Sec.struct. author ......hhhhhhhhhhhhhhh..hhh..eeeee..hhhhhhhhhhhhh....eeee..------------...........eeeee.....--.hhhhhhh....eeee.eee...hhh.....eee........hhh............ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------PUR_PYR_PR_TR-------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1nul B   3 EKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCI------------VLKRAEGDGEGFIVIDDLVDT--TAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR 152
                                    12        22        32        42        52       | -         -|       82        92|  |   102       112       122       132       142       152
                                                                                    60           73                  93 96

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: PRTase-like (145)

Superfamily: PRTase-like (145)

Family: Phosphoribosyltransferases (PRTases) (100)

Protein domain: Xanthine-guanine PRTase (XPRTase) (6)

Escherichia coli [TaxId: 562] (5)

1a	d1nula_	A:
1b	d1nulb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.2020, no name defined] (117)

Escherichia coli. Organism_taxid: 562 (2)

1a	1nulA00	A:3-152
1b	1nulB00	B:3-152

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: PRTase-like (59)

Family: Pribosyltran (59)

Escherichia coli (strain K12) (1)

1a	Pribosyltran-1nulB01	B:3-112
1b	Pribosyltran-1nulB02	B:3-112

Asymmetric Unit(hide GO term definitions)

Chain A,B (XGPT_ECOLI | P0A9M5)

molecular function
	GO:0004422	hypoxanthine phosphoribosyltransferase activity	Catalysis of the reaction: IMP + diphosphate = hypoxanthine + 5-phospho-alpha-D-ribose 1-diphosphate.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016757	transferase activity, transferring glycosyl groups	Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
	GO:0000310	xanthine phosphoribosyltransferase activity	Catalysis of the reaction: 5-phospho-alpha-D-ribose 1-diphosphate + xanthine = (9-D-ribosylxanthine)-5'-phosphate + diphosphate.
biological process
	GO:0032263	GMP salvage	Any process which produces guanosine monophosphate from derivatives of it, without de novo synthesis.
	GO:0032264	IMP salvage	Any process which produces inosine monophosphate from derivatives of it, without de novo synthesis.
	GO:0032265	XMP salvage	Any process which produces xanthosine monophosphate from derivatives of it, without de novo synthesis.
	GO:0009116	nucleoside metabolic process	The chemical reactions and pathways involving a nucleoside, a nucleobase linked to either beta-D-ribofuranose (a ribonucleoside) or 2-deoxy-beta-D-ribofuranose, (a deoxyribonucleoside), e.g. adenosine, guanosine, inosine, cytidine, uridine and deoxyadenosine, deoxyguanosine, deoxycytidine and thymidine (= deoxythymidine).
	GO:0006166	purine ribonucleoside salvage	Any process which produces a purine nucleoside from derivatives of it, without de novo synthesis.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Met A:24 - Pro A:25	[ RasMol ]
		Met B:24 - Pro B:25	[ RasMol ]
		Ser A:36 - Arg A:37	[ RasMol ]
		Ser B:36 - Arg B:37	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1nul
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	XGPT_ECOLI \| P0A9M5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.4.2.22
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	XGPT_ECOLI \| P0A9M5
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	XGPT_ECOLI \| P0A9M5	:	1a95 1a96 1a97 1a98

(no "Related Entries Specified in the PDB File" available for 1NUL)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (14, 14)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File