Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF RABBIT APO-S100A11 (19 MODELS)
 
Authors :  A. C. Dempsey, M. P. Walsh, G. S. Shaw
Date :  27 Jan 03  (Deposition) - 15 Jul 03  (Release) - 09 Jun 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (19x)
Keywords :  Calcium-Binding Protein, Ef Hand, Helix-Loop-Helix, S100, Annexin, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. C. Dempsey, M. P. Walsh, G. S. Shaw
Unmasking The Annexin I Interaction From The Structure Of Apo-S100A11
Structure V. 11 887 2003
PubMed-ID: 12842051  |  Reference-DOI: 10.1016/S0969-2126(03)00126-6
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CALGIZZARIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: S100A11 OR S100C OR PCALG
    Organism Common: RABBIT
    Organism Scientific: ORYCTOLAGUS CUNICULUS
    Organism Taxid: 9986
    Synonym: S100C PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (19x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1NSH)

(-) Sites  (0, 0)

(no "Site" information available for 1NSH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1NSH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1NSH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1NSH)

(-) PROSITE Motifs  (3, 6)

NMR Structure (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.S10AB_RABIT52-87
 		  2A:51-86
B:51-86
2S100_CABPPS00303 S-100/ICaBP type calcium binding protein signature.S10AB_RABIT60-81
 		  2A:59-80
B:59-80
3EF_HAND_1PS00018 EF-hand calcium-binding domain.S10AB_RABIT65-77
 		  2A:64-76
B:64-76

(-) Exons   (0, 0)

(no "Exon" information available for 1NSH)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:101
 aligned with S10AB_RABIT | P24480 from UniProtKB/Swiss-Prot  Length:102

    Alignment length:101
                                    11        21        31        41        51        61        71        81        91       101 
          S10AB_RABIT     2 SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGGLAVACHESFVKAAPPQKRF 102
               SCOP domains d1nsha_ A: Calcyclin (S100)                                                                           SCOP domains
               CATH domains 1nshA00 A:1-101 EF-hand                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh.........hhhhhhhhhhhhhh.hhhhh..hhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------------------EF_HAND_2  PDB: A:51-86             --------------- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------S100_CABP  PDB: A:59-8--------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------EF_HAND_1    ------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 1nsh A   1 SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGGLAVACHESFVKAAPPQKRF 101
                                    10        20        30        40        50        60        70        80        90       100 


Chain B from PDB  Type:PROTEIN  Length:101
 aligned with S10AB_RABIT | P24480 from UniProtKB/Swiss-Prot  Length:102

    Alignment length:101
                                    11        21        31        41        51        61        71        81        91       101 
          S10AB_RABIT     2 SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGGLAVACHESFVKAAPPQKRF 102
               SCOP domains d1nshb_ B: Calcyclin (S100)                                                                           SCOP domains
               CATH domains 1nshB00 B:1-101 EF-hand                                                                               CATH domains
           Pfam domains (1) -----S_100-1nshB01 B:6-49                        ---------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -----S_100-1nshB02 B:6-49                        ---------------------------------------------------- Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh.........hhhhhhhhhhhhhh.hhhhh..hhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------------------EF_HAND_2  PDB: B:51-86             --------------- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------S100_CABP  PDB: B:59-8--------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------EF_HAND_1    ------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 1nsh B   1 SRPTETERCIESLIAVFQKYAGKDGHSVTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDLNSDGQLDFQEFLNLIGGLAVACHESFVKAAPPQKRF 101
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 2)

NMR Structure
(-)
Clan: EF_hand (270)

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A,B   (S10AB_RABIT | P24480)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0048306    calcium-dependent protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1nsh)
 
  Sites
(no "Sites" information available for 1nsh)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1nsh)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1nsh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  S10AB_RABIT | P24480
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  S10AB_RABIT | P24480
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1NSH)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1NSH)