|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1NQY) |
Sites (0, 0)| (no "Site" information available for 1NQY) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1NQY) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1NQY) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1NQY) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1NQY) |
Exons (0, 0)| (no "Exon" information available for 1NQY) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:170 aligned with Q9RV46_DEIRA | Q9RV46 from UniProtKB/TrEMBL Length:194 Alignment length:186 14 24 34 44 54 64 74 84 94 104 114 124 134 144 154 164 174 184 Q9RV46_DEIRA 5 HDPLDDIQADPWALWLSGRTRTALELPHYRRAAVLVALTREADPRVLLTVRSSELPTHKGQIAFPGGSLDAGETPTQAALREAQEEVALDPAAVTLLGELDDVFTPVGFHVTPVLGRIAPEALDTLRVTPEVAQIITPTLAELRAVPLVRERRTLPDGTEVPLYRYPWRGLDIWGMTARVLHDLLE 190 SCOP domains d1nqya_ A: Coenzym e A pyrophosphatase SCOP domains CATH domains 1nqyA00 A:5-190 Nu cleoside Triphosphate Py rophosphohydrolase CATH domains Pfam domains ------------------ -NUDIX-1nqyA01 A:34-164 -------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1nqy A 5 HDPLDDIQADPWALWLSG----------YRRAAVLVALTREADPRVLLTVRS------KGQIAFPGGSLDAGETPTQAALREAQEEVALDPAAVTLLGELDDVFTPVGFHVTPVLGRIAPEALDTLRVTPEVAQIITPTLAELRAVPLVRERRTLPDGTEVPLYRYPWRGLDIWGMTARVLHDLLE 190 14 | - 34 44 54 | 64 74 84 94 104 114 124 134 144 154 164 174 184 22 33 56 63
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q9RV46_DEIRA | Q9RV46)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|