Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF OXYTETRACYCLINE ACYL CARRIER PROTEIN
 
Authors :  S. C. Findlow, C. Winsor, T. J. Simpson, J. Crosby, M. P. Crump
Date :  21 Jan 03  (Deposition) - 04 Nov 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (28x)
Keywords :  Nmr, Solution Structure, Oxytetracycline, Polyketide Synthase, Dynamics, Acp, Biosynthetic Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. C. Findlow, C. Winsor, T. J. Simpson, J. Crosby, M. P. Crump
Solution Structure And Dynamics Of Oxytetracycline Polyketide Synthase Acyl Carrier Protein From Streptomyces Rimosus
Biochemistry V. 42 8423 2003
PubMed-ID: 12859187  |  Reference-DOI: 10.1021/BI0342259
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - OXYTETRACYCLINE POLYKETIDE SYNTHASE ACYL CARRIER PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PT-7
    Expression System Strain: BL-21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: OTCY1-3
    Organism Scientific: STREPTOMYCES RIMOSUS
    Organism Taxid: 1927

 Structural Features

(-) Chains, Units

  
NMR Structure (28x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1NQ4)

(-) Sites  (0, 0)

(no "Site" information available for 1NQ4)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1NQ4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1NQ4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1NQ4)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CARRIERPS50075 Carrier protein (CP) domain profile.ACPX_STRRM3-81  1A:3-81
2PHOSPHOPANTETHEINEPS00012 Phosphopantetheine attachment site.ACPX_STRRM36-51  1A:36-51

(-) Exons   (0, 0)

(no "Exon" information available for 1NQ4)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:95
 aligned with ACPX_STRRM | P43677 from UniProtKB/Swiss-Prot  Length:95

    Alignment length:95
                                    10        20        30        40        50        60        70        80        90     
            ACPX_STRRM    1 MTLLTLSDLLTLLRECAGEEESIDLGGDVEDVAFDALGYDSLALLNTVGRIERDYGVQLGDDAVEKATTPRALIEMTNASLTGASPSAGGAARDK 95
               SCOP domains d1nq4a_ A: Oxytetracycline polyketide synthase acyl carrier                                     SCOP domains
               CATH domains 1nq4A00 A:1-95  [code=1.10.1200.10, no name defined]                                            CATH domains
               Pfam domains ------PP-binding-1nq4A01 A:7-77                                              ------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhh..............hhhhhh..hhhhhhhhhhhhhhh......hhhhhh.hhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --CARRIER  PDB: A:3-81 UniProt: 3-81                                             -------------- PROSITE (1)
                PROSITE (2) -----------------------------------PHOSPHOPANTETHEI-------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                  1nq4 A  1 MTLLTLSDLLTLLRECAGEEESIDLGGDVEDVAFDALGYDSLALLNTVGRIERDYGVQLGDDAVEKATTPRALIEMTNASLTGASPSAGGAARDK 95
                                    10        20        30        40        50        60        70        80        90
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: PP-binding (27)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (ACPX_STRRM | P43677)
biological process
    GO:0017000    antibiotic biosynthetic process    The chemical reactions and pathways resulting in the formation of an antibiotic, a substance produced by or derived from certain fungi, bacteria, and other organisms, that can destroy or inhibit the growth of other microorganisms.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1nq4)
 
  Sites
(no "Sites" information available for 1nq4)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1nq4)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1nq4
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ACPX_STRRM | P43677
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ACPX_STRRM | P43677
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1NQ4)

(-) Related Entries Specified in the PDB File

7154 1H AND 15N CHEMICAL SHIFT DATA ENTRY