1NML - JenaLib

Title :   DI-HAEMIC CYTOCHROME C PEROXIDASE FROM PSEUDOMONAS NAUTICA 617, FORM IN (PH 4.0)

Authors :   J. M. Dias, C. Bonifacio, T. Alves, A. S. Pereira, D. Bourgeois, I. Moura M. J. Romao

Date :   10 Jan 03 (Deposition) - 13 Jan 04 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A
Biol. Unit 1: A  (1x)
Biol. Unit 2: A  (2x)

Keywords :   Oxidoreductase, Peroxidase, Di-Haem, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. M. Dias, T. Alves, A. S. Pereira, D. Bourgeois, I. Moura
Structural Basis For The Mechanism Of Ca(2+) Activation Of The Di-Heme Cytochrome C Peroxidase From Pseudomonas Nautic 617
Structure V. 12 961 2004
PubMed-ID: 15274917 | Reference-DOI: 10.1016/J.STR.2004.03.025
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (6, 6)

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ILE A:49 , SER A:50 , CYS A:51 , CYS A:54 , HIS A:55 , ILE A:69 , HIS A:71 , TRP A:73 , ARG A:78 , ASN A:79 , PRO A:81 , ASN A:89 , GLN A:92 , PHE A:93 , PRO A:108 , GLY A:112 , MET A:115 , ILE A:156 , GLU A:160 , ARG A:246 , CIT A:502 , HOH A:633 , HOH A:643 , HOH A:725	BINDING SITE FOR RESIDUE HEM A 401
2	AC2	SOFTWARE	GLU A:25 , CYS A:197 , CYS A:200 , HIS A:201 , PHE A:214 , GLY A:215 , LEU A:216 , ARG A:246 , ALA A:247 , SER A:248 , LEU A:250 , ILE A:253 , TYR A:259 , PHE A:260 , HIS A:261 , ALA A:271 , MET A:275 , LEU A:280 , THR A:282 , CIT A:501 , HOH A:676	BINDING SITE FOR RESIDUE HEM A 402
3	AC3	SOFTWARE	ASN A:79 , PHE A:93 , TRP A:94 , ARG A:246 , SER A:248 , PHE A:260 , HIS A:261 , HEM A:402	BINDING SITE FOR RESIDUE CIT A 501
4	AC4	SOFTWARE	LEU A:43 , SER A:44 , SER A:50 , CYS A:51 , MET A:115 , SER A:116 , SER A:117 , HEM A:401 , HOH A:631 , HOH A:644 , HOH A:675	BINDING SITE FOR RESIDUE CIT A 502
5	AC5	SOFTWARE	SER A:267 , LEU A:268 , GLU A:269 , VAL A:293 , LYS A:297 , HOH A:778 , HOH A:783 , HOH A:872	BINDING SITE FOR RESIDUE CIT A 503
6	AC6	SOFTWARE	LEU A:26 , THR A:27 , GLN A:28 , VAL A:31 , GLU A:237 , GLN A:279 , HOH A:687 , HOH A:699 , HOH A:863 , HOH A:941	BINDING SITE FOR RESIDUE CIT A 504

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:316
 aligned with P83787_MARHY | P83787 from UniProtKB/TrEMBL  Length:326

    Alignment length:326
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320      
         P83787_MARHY     1 DNLMERANSMFEPIPKYPPVIDGNELTQAKVELGKMEFFEPRLSSSHLISCNTCHNVGLGGDDELPTSIGHGWQKGPRNSPTVFNAVFNAAQFWDGRAADLAEQAKGPVQAGVEMSSTPDRVVATLKSMPEYIERFEDAFPGQENPVTFDNMAVAIEAYEATLITPEAPFDKYLRGDTSALNESEKEGLALFMDRGCTACHSGVNLGGQNYYPFGLVAKPGAEILPEGDKGRFSVTETASDEYVFRASPLRNIELTAPYFHSGAVWSLEEAVAVMGTAQLGTELNNDEVKSIVAFLKTLTGNVPEVTYPVLPPSTANTPKPVDMIP 326
               SCOP domains d1nmla1 A:1-166 Di-heme cytochrome c peroxidase                                                                                                                       d1nmla2 A:167-326 Di-heme cytochrome c peroxidase                                                                                                                SCOP domains
               CATH domains 1nmlA01         1nmlA02 A:17-164,A:303-326 Cytochrome c                                                                                                             1nmlA01 A:1-16,A:165-302 Cytochrome c                                                                                                     1nmlA02 Cytochrome c     CATH domains
               Pfam domains --------------------------CCP_MauG-1nmlA01 A:27-181                                                                                                                                  ---Cytochrom_C-1nmlA02 A:185-300                                                                                       -------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhh...............hhhhhhhhhhhhhhhhhh.....hhhhhh.............................hhhhh.....eee..hhhhhh.hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh....hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh.hhhhh....ee.eeeee.----------...eeeee.hhh.eeee.....hhhhh..........hhhhhhhhh.........hhhhhhhhhhhhhhhh.......................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1nml A   1 DNLMERANSMFEPIPKYPPVIDGNELTQAKVELGKMEFFEPRLSSSHLISCNTCHNVGLGGDDELPTSIGHGWQKGPRNSPTVFNAVFNAAQFWDGRAADLAEQAKGPVQAGVEMSSTPDRVVATLKSMPEYIERFEDAFPGQENPVTFDNMAVAIEAYEATLITPEAPFDKYLRGDTSALNESEKEGLALFMDRGCTACHSGVNLGGQNYYPFGLVAK----------KGRFSVTETASDEYVFRASPLRNIELTAPYFHSGAVWSLEEAVAVMGTAQLGTELNNDEVKSIVAFLKTLTGNVPEVTYPVLPPSTANTPKPVDMIP 326
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210        |-       230       240       250       260       270       280       290       300       310       320      
                                                                                                                                                                                                                                                    219        230

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (2, 2)

Gene Ontology (5, 5)

Asymmetric Unit(hide GO term definitions)

Chain A (P83787_MARHY | P83787)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CIT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:257 - Pro A:258	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1nml
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	P83787_MARHY \| P83787
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	1.11.1.5
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description