Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  2.0 A STRUCTURE OF PROTEIN OF UNKNOWN FUNCTION FROM THERMOPLASMA ACIDOPHILUM
 
Authors :  R. Sanishvili, A. Edwards, D. Christendat, Midwest Center For Stru Genomics (Mcsg)
Date :  23 Dec 02  (Deposition) - 15 Jul 03  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (3x)
Keywords :  Structural Genomics, Four Helixbundle, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Sanishvili, M. Pennycooke, J. Gu, X. Xu, A. Joachimiak, A. M. Edwards, D. Christendat
Crystal Structure Of The Hypothetical Protein Ta1238 From Thermoplasma Acidophilum: A New Type Of Helical Super-Bundle.
J. Struct. Funct. Genom. V. 5 231 2004
PubMed-ID: 15704011  |  Reference-DOI: 10.1007/S10969-005-3789-1

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN TA1238
    Chains: A
    Engineered: YES
    Expression System: THERMOPLASMA ACIDOPHILUM
    Expression System Taxid: 2303
    Gene: TA1238
    Organism Scientific: THERMOPLASMA ACIDOPHILUM
    Organism Taxid: 2303

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (1x): A
Biological Unit 2 (3x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1NIG)

(-) Sites  (0, 0)

(no "Site" information available for 1NIG)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1NIG)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1NIG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1NIG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1NIG)

(-) Exons   (0, 0)

(no "Exon" information available for 1NIG)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:146
 aligned with Q9HIT9_THEAC | Q9HIT9 from UniProtKB/TrEMBL  Length:152

    Alignment length:148
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140        
         Q9HIT9_THEAC     1 MDIKRYCPVTDSELPADHVYFKFRSEIEAAEAYLGLAISEGIKVRETREILDIIDTVYNSLSDPESKLNDFQEKRLNFTEEDWYDIKEKANNGNRWSLYMFLARSAVDSAVYWSYRMKETEEFKEIVKEEMISKLLKAGYVILRESLG 148
               SCOP domains d1niga_ A: Hypothetical protein Ta1238                                                                                                               SCOP domains
               CATH domains 1nigA00 A:1-148  [code=1.20.1200.10, no name defined]                                                                                                CATH domains
               Pfam domains -----DUF1940-1nigA01 A:6-148                                                                                                                         Pfam domains
         Sec.struct. author ...eeee....eeee..hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh...--...hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1nig A   1 MDIKRYCPVTDSELPADHVYFKFRSEIEAAEAYLGLAISEGIKVRETREILDIIDTVYNSLSD--SKLNDFQEKRLNFTEEDWYDIKEKANNGNRWSLYMFLARSAVDSAVYWSYRMKETEEFKEIVKEEMISKLLKAGYVILRESLG 148
                                    10        20        30        40        50        60  |  |  70        80        90       100       110       120       130       140        
                                                                                         63 66
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: no clan defined [family: DUF1940] (1)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1NIG)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1nig)
 
  Sites
(no "Sites" information available for 1nig)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1nig)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1nig
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9HIT9_THEAC | Q9HIT9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9HIT9_THEAC | Q9HIT9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1NIG)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1NIG)