|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1NEI) |
(no "Site" information available for 1NEI) |
(no "SS Bond" information available for 1NEI) |
(no "Cis Peptide Bond" information available for 1NEI) |
(no "SAP(SNP)/Variant" information available for 1NEI) |
(no "PROSITE Motif" information available for 1NEI) |
(no "Exon" information available for 1NEI) |
NMR StructureChain A from PDB Type:PROTEIN Length:60 aligned with YOAG_ECOLI | P64496 from UniProtKB/Swiss-Prot Length:60 Alignment length:60 10 20 30 40 50 60 YOAG_ECOLI 1 MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 SCOP domains d1neia_ A: Hypothetical protein YoaG SCOP domains CATH domains ------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------ Transcript 1nei A 1 MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:60 aligned with YOAG_ECOLI | P64496 from UniProtKB/Swiss-Prot Length:60 Alignment length:60 10 20 30 40 50 60 YOAG_ECOLI 1 MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 60 SCOP domains d1neib_ B: Hypothetical protein YoaG SCOP domains CATH domains ------------------------------------------------------------ CATH domains Pfam domains (1) DUF1869-1neiB01 B:201-260 Pfam domains (1) Pfam domains (2) DUF1869-1neiB02 B:201-260 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------ Transcript 1nei B 201 MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW 260 210 220 230 240 250 260
|
NMR Structure
|
(no "CATH Domain" information available for 1NEI) |
NMR Structure
|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 1NEI)
|
|
|
|
|
|
|