Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theoretical Model
collapse expand < >
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  HOMOLOGY MODELING CALCULATION OF COPPER(II) HALOCYANIN FROM NATRONOBACTERIUM PHARAONIS BACTERIA
 
Authors :  D. Monleon, F. Ribes, H. R. Jimenez, J. M. Moratal, B. Celda
Date :  28 Oct 02  (Deposition) - 27 Nov 02  (Release) - 22 Mar 05  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A  (5x)
Keywords :  Homology Model, Blue Copper Protein, Electron Transfer (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Monleon, F. Ribes, H. R. Jimenez, J. M. Moratal, B. Celda
Nmr And Homology Modeling Studies Of Copper(Ii)-Halocyanin From Natronobacterium Pharaonis Bacteria
Inorg. Chim. Acta. V. 357 1111 2004
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HALOCYANIN
    Chains: A
    Organism Common: ARCHAEA
    Organism Scientific: NATRONOMONAS PHARAONIS

 Structural Features

(-) Chains, Units

  
Theoretical Model (5x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1N3D)

(-) Sites  (0, 0)

(no "Site" information available for 1N3D)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1N3D)

(-) Cis Peptide Bonds  (1, 5)

Theoretical Model
No.ModelResidues
11, 2, 3, 4, 5Asp A:17 -Pro A:18

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1N3D)

(-) PROSITE Motifs  (1, 1)

Theoretical Model (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1COPPER_BLUEPS00196 Type-1 copper (blue) proteins signature.HCY_NATPH142-156  1A:72-86

(-) Exons   (0, 0)

(no "Exon" information available for 1N3D)

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:93
 aligned with HCY_NATPH | P39442 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:93
                                    80        90       100       110       120       130       140       150       160   
            HCY_NATPH    71 DEVVVVTGAGNNGFAFDPAAIRVDVGTTVTWEWTGDGGAHNVVSEPESDFEFESDRVDEEGFTFEQTFDDEGVALYVCTPHRAQGMYGAVIVE 163
               SCOP domains --------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..........ee..eeee....eeeeee.........ee..................eeeee......eeeehhhhhh...eeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------COPPER_BLUE    ------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------- Transcript
                 1n3d A   1 DEVVVVTGAGNNGFAFDPAAIRVDVGTTVTWEWTGDGGAHNVVSEPESDFEFESDRVDEEGFTFEQTFDDEGVALYVCTPHRAQGMYGAVIVE  93
                                    10        20        30        40        50        60        70        80        90
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 1N3D)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1N3D)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1N3D)

(-) Gene Ontology  (6, 6)

Theoretical Model(hide GO term definitions)
Chain A   (HCY_NATPH | P39442)
molecular function
    GO:0005507    copper ion binding    Interacting selectively and non-covalently with copper (Cu) ions.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1n3d)
 
  Sites
(no "Sites" information available for 1n3d)
 
  Cis Peptide Bonds
    Asp A:17 - Pro A:18   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1n3d
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HCY_NATPH | P39442
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HCY_NATPH | P39442
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1N3D)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1N3D)