1N2P - JenaLib

Theoretical Model (81, 81)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_004500	I	30	M	MYP0_HUMAN	Disease (CMT1B)	---	A	I	40	M
02	UniProt	VAR_004501	V	32	F	MYP0_HUMAN	Disease (CMT1B)	---	A	V	42	F
03	UniProt	VAR_004502	T	34	I	MYP0_HUMAN	Disease (CMT1B)	---	A	T	44	I
04	UniProt	VAR_015971	D	35	Y	MYP0_HUMAN	Disease (CMTDID)	121913596	A	D	45	Y
05	UniProt	VAR_054393	H	39	P	MYP0_HUMAN	Disease (CMT1B)	371856018	A	H	49	P
06	UniProt	VAR_004503	S	44	F	MYP0_HUMAN	Disease (CMT2I)	121913598	A	S	54	F
07	UniProt	VAR_029971	S	51	F	MYP0_HUMAN	Disease (CMT1B)	---	A	S	61	F
08	UniProt	VAR_004504	S	54	C	MYP0_HUMAN	Disease (CMT1B)	---	A	S	64	C
09	UniProt	VAR_004505	S	54	P	MYP0_HUMAN	Disease (CMT1B)	---	A	S	64	P
10	UniProt	VAR_054396	E	56	K	MYP0_HUMAN	Unclassified	---	A	E	66	K
11	UniProt	VAR_004506	V	58	F	MYP0_HUMAN	Disease (CMT1B)	---	A	V	68	F
12	UniProt	VAR_029972	D	60	H	MYP0_HUMAN	Disease (CMT2I)	121913604	A	D	70	H
13	UniProt	VAR_031885	D	61	G	MYP0_HUMAN	Polymorphism	786204119	A	D	71	G
14	UniProt	VAR_015972	I	62	F	MYP0_HUMAN	Disease (CMT1B)	121913602	A	I	72	F
15	UniProt	VAR_029973	I	62	M	MYP0_HUMAN	Disease (CMT2I)	121913605	A	I	72	M
16	UniProt	VAR_004508	S	63	C	MYP0_HUMAN	Disease (DSS)	121913585	A	S	73	C
17	UniProt	VAR_004509	S	63	F	MYP0_HUMAN	Disease (CMT1B)	121913585	A	S	73	F
18	UniProt	VAR_031886	T	65	A	MYP0_HUMAN	Disease (CMT1B)	---	A	T	75	A
19	UniProt	VAR_029974	T	65	I	MYP0_HUMAN	Disease (CMT1B)	---	A	T	75	I
20	UniProt	VAR_004511	Y	68	C	MYP0_HUMAN	Disease (CMT1B)	---	A	Y	78	C
21	UniProt	VAR_015973	D	75	V	MYP0_HUMAN	Disease (CMT2J)	121913597	A	D	85	V
22	UniProt	VAR_004512	S	78	L	MYP0_HUMAN	Disease (CMT1B)	121913601	A	S	88	L
23	UniProt	VAR_031887	S	78	W	MYP0_HUMAN	Disease (CMT1B)	---	A	S	88	W
24	UniProt	VAR_004513	H	81	R	MYP0_HUMAN	Disease (CMT2I)	121913594	A	H	91	R
25	UniProt	VAR_031888	H	81	Y	MYP0_HUMAN	Polymorphism	281865123	A	H	91	Y
26	UniProt	VAR_004514	Y	82	C	MYP0_HUMAN	Disease (DSS)	---	A	Y	92	C
27	UniProt	VAR_015974	I	89	N	MYP0_HUMAN	Disease (CMT2I)	267607244	A	I	99	N
28	UniProt	VAR_004515	D	90	E	MYP0_HUMAN	Disease (CMT1B)	121913584	A	D	100	E
29	UniProt	VAR_015975	V	92	M	MYP0_HUMAN	Disease (CMT2I)	267607245	A	V	102	M
30	UniProt	VAR_004516	G	93	E	MYP0_HUMAN	Disease (CMT1B)	---	A	G	103	E
31	UniProt	VAR_004517	K	96	E	MYP0_HUMAN	Disease (CMT1B)	121913583	A	K	106	E
32	UniProt	VAR_029975	E	97	V	MYP0_HUMAN	Disease (CMT2J)	121913606	A	E	107	V
33	UniProt	VAR_004518	R	98	C	MYP0_HUMAN	Disease (DSS)	121913590	A	R	108	C
34	UniProt	VAR_004519	R	98	H	MYP0_HUMAN	Disease (CMT1B)	121913589	A	R	108	H
35	UniProt	VAR_004520	R	98	P	MYP0_HUMAN	Disease (CMT1B)	121913589	A	R	108	P
36	UniProt	VAR_004521	R	98	S	MYP0_HUMAN	Disease (CMT1B)	---	A	R	108	S
37	UniProt	VAR_004522	I	99	T	MYP0_HUMAN	Disease (CMT1B)	---	A	I	109	T
38	UniProt	VAR_004523	W	101	C	MYP0_HUMAN	Disease (CMT1B)	---	A	W	111	C
39	UniProt	VAR_015976	G	103	E	MYP0_HUMAN	Disease (CMT1B)	121913600	A	G	113	E
40	UniProt	VAR_031889	D	109	N	MYP0_HUMAN	Disease (CMT1B)	---	A	D	119	N
41	UniProt	VAR_029976	G	110	D	MYP0_HUMAN	Disease (DSS)	---	A	G	120	D
42	UniProt	VAR_004524	I	112	T	MYP0_HUMAN	Disease (CMT1B)	---	A	I	122	T
43	UniProt	VAR_031890	V	113	F	MYP0_HUMAN	Polymorphism	281865126	A	V	123	F
44	UniProt	VAR_029977	V	113	I	MYP0_HUMAN	Unclassified	---	A	V	123	I
45	UniProt	VAR_004525	I	114	T	MYP0_HUMAN	Disease (DSS)	267607241	A	I	124	T
46	UniProt	VAR_004526	N	116	H	MYP0_HUMAN	Disease (DSS)	267607242	A	N	126	H
47	UniProt	VAR_021609	D	118	N	MYP0_HUMAN	Disease (CMT2I)	---	A	D	128	N
48	UniProt	VAR_031891	Y	119	C	MYP0_HUMAN	Polymorphism	879254038	A	Y	129	C
49	UniProt	VAR_004528	N	122	S	MYP0_HUMAN	Disease (CMT1B)	---	A	N	132	S
50	UniProt	VAR_015977	G	123	C	MYP0_HUMAN	Disease (DSS)	---	A	G	133	C
51	UniProt	VAR_029978	T	124	K	MYP0_HUMAN	Disease (CHN)	121913595	A	T	134	K
52	UniProt	VAR_004529	T	124	M	MYP0_HUMAN	Disease (CMT2J)	121913595	A	T	134	M
53	UniProt	VAR_004531	C	127	Y	MYP0_HUMAN	Disease (DSS)	---	A	C	137	Y
54	UniProt	VAR_004532	D	128	E	MYP0_HUMAN	Disease (CMT1B)	---	A	D	138	E
55	UniProt	VAR_004533	D	128	N	MYP0_HUMAN	Disease (DSS)	267607243	A	D	138	N
56	UniProt	VAR_004534	K	130	R	MYP0_HUMAN	Disease (DSS)	281865127	A	K	140	R
57	UniProt	VAR_015978	N	131	K	MYP0_HUMAN	Disease (ROULS)	121913599	A	N	141	K
58	UniProt	VAR_004535	P	132	L	MYP0_HUMAN	Disease (CMT1B)	---	A	P	142	L
59	UniProt	VAR_004536	D	134	E	MYP0_HUMAN	Disease (CMT1B)	---	A	D	144	E
60	UniProt	VAR_029979	D	134	G	MYP0_HUMAN	Disease (CMT1B)	---	A	D	144	G
61	UniProt	VAR_004537	D	134	N	MYP0_HUMAN	Disease (CMT1B)	---	A	D	144	N
62	UniProt	VAR_004538	I	135	L	MYP0_HUMAN	Disease (DSS)	879253858	A	I	145	L
63	UniProt	VAR_004539	I	135	T	MYP0_HUMAN	Disease (CMT1B)	121913587	A	I	145	T
64	UniProt	VAR_015979	V	136	E	MYP0_HUMAN	Disease (DSS)	---	A	V	146	E
65	UniProt	VAR_004540	G	137	S	MYP0_HUMAN	Disease (CMT1B)	121913588	A	G	147	S
66	UniProt	VAR_029980	K	138	N	MYP0_HUMAN	Disease (CMT1B)	---	A	K	148	N
67	UniProt	VAR_029981	T	139	N	MYP0_HUMAN	Disease (CMT1B)	---	A	T	149	N
68	UniProt	VAR_029982	S	140	T	MYP0_HUMAN	Disease (CMT1B)	572010627	A	S	150	T
69	UniProt	VAR_004541	T	143	M	MYP0_HUMAN	Disease (CMT1B)	750724650	A	T	153	M
70	UniProt	VAR_029983	Y	145	S	MYP0_HUMAN	Disease (CMT1B)	121913603	A	Y	155	S
71	UniProt	VAR_029984	V	146	F	MYP0_HUMAN	Disease (CMT1B)	---	A	V	156	F
72	UniProt	VAR_015980	I	162	M	MYP0_HUMAN	Disease (CMT2I)	267607246	A	I	172	M
73	UniProt	VAR_004542	G	163	R	MYP0_HUMAN	Disease (CMT1B)	281865128	A	G	173	R
74	UniProt	VAR_004543	G	167	A	MYP0_HUMAN	Disease (DSS)	---	A	G	177	A
75	UniProt	VAR_004544	G	167	R	MYP0_HUMAN	Disease (DSS)	121913586	A	G	177	R
76	UniProt	VAR_029985	L	170	R	MYP0_HUMAN	Disease (CMT1B)	---	A	L	180	R
77	UniProt	VAR_031892	A	221	T	MYP0_HUMAN	Disease (DSS)	---	A	A	231	T
78	UniProt	VAR_054397	D	224	Y	MYP0_HUMAN	Disease (CMT1B)	267607247	A	D	234	Y
79	UniProt	VAR_054398	R	227	S	MYP0_HUMAN	Disease (CMT1B)	---	A	R	237	S
80	UniProt	VAR_021610	K	236	E	MYP0_HUMAN	Disease (CMT2I)	---	A	K	246	E
81	UniProt	VAR_004545	R	244	L	MYP0_HUMAN	Polymorphism	749722729	A	R	254	L

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:258
 aligned with MYP0_HUMAN | P25189 from UniProtKB/Swiss-Prot  Length:248

    Alignment length:258
                                      1                                                                                                                                                                                                                                                       
                                     -|       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240        
           MYP0_HUMAN     - ----------MAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK 248
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........................................eee...eeeee....eee..eee.........eeeeeeee......eeeeeee..eeee.........eee..........eee...hhhh.eeeeeeee.......eeeeeeeeee..................................................................................................... Sec.struct. author
             SAPs(SNPs) (1) ---------------------------------------M-F-IY---P----F------F--C-K-F-HGFC-A--C------V--L--RC------NE-ME--EVCT-C-E-----ND-TFT-H-NC--SCK--YE-RKL-ELESNNT--M-SF---------------MR---A--R--------------------------------------------------T--Y--S--------E-------L---- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------P-------MF-I------------W--Y----------------H--------------I----------M---N-----GT-------------------------------R--------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------------------------------------------------------------------------------------------------------P-----------------------------------N------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (3)
             SAPs(SNPs) (4) -----------------------------------------------------------------------------------------------------------S------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (4)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MYELIN_P0    ---------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1n2p A   1 MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK 258
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

Theoretical Model(hide GO term definitions)

Chain A (MYP0_HUMAN | P25189)

molecular function
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
	GO:0007268	chemical synaptic transmission	The vesicular release of classical neurotransmitter molecules from a presynapse, across a chemical synapse, the subsequent activation of neurotransmitter receptors at the postsynapse of a target cell (neuron, muscle, or secretory cell) and the effects of this activation on the postsynaptic membrane potential and ionic composition of the postsynaptic cytosol. This process encompasses both spontaneous and evoked release of neurotransmitter and all parts of synaptic vesicle exocytosis. Evoked transmission starts with the arrival of an action potential at the presynapse.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
cellular component
	GO:0016323	basolateral plasma membrane	The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043209	myelin sheath	An electrically insulating fatty layer that surrounds the axons of many neurons. It is an outgrowth of glial cells: Schwann cells supply the myelin for peripheral neurons while oligodendrocytes supply it to those of the central nervous system.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0005791	rough endoplasmic reticulum	The rough (or granular) endoplasmic reticulum (ER) has ribosomes adhering to the outer surface; the ribosomes are the site of translation of the mRNA for those proteins which are either to be retained within the cisternae (ER-resident proteins), the proteins of the lysosomes, or the proteins destined for export from the cell. Glycoproteins undergo their initial glycosylation within the cisternae.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1n2p
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MYP0_HUMAN \| P25189
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	118200
		Disease Information	:	OMIM
	145900
		Disease Information	:	OMIM
	180800
		Disease Information	:	OMIM
	605253
		Disease Information	:	OMIM
	607677
		Disease Information	:	OMIM
	607736
		Disease Information	:	OMIM
	607791
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (1, 1)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (81, 81)