Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SCHIZOSACCHAROMYCES POMBE RIBOFLAVIN KINASE REVEALS A NOVEL ATP AND RIBOFLAVIN BINDING FOLD
 
Authors :  S. Bauer, K. Kemter, A. Bacher, R. Huber, M. Fischer, S. Steinbacher
Date :  11 Oct 02  (Deposition) - 25 Feb 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.45
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Kinase, Phosphoryl Transferases, Flavin Cofactors, Metal Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Bauer, K. Kemter, A. Bacher, R. Huber, M. Fischer, S. Steinbacher
Crystal Structure Of Schizosaccharomyces Pombe Riboflavin Kinase Reveals A Novel Atp And Riboflavin Binding Fold
J. Mol. Biol. V. 326 1463 2003
PubMed-ID: 12595258  |  Reference-DOI: 10.1016/S0022-2836(03)00059-7
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PUTATIVE RIBOFLAVIN KINASE
    ChainsA, B
    EC Number2.7.1.26
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPNCO
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneSPCC18.16C
    Organism CommonFISSION YEAST
    Organism ScientificSCHIZOSACCHAROMYCES POMBE
    Organism Taxid4896

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric Unit (2, 4)
No.NameCountTypeFull Name
1ADP2Ligand/IonADENOSINE-5'-DIPHOSPHATE
2FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1ADP1Ligand/IonADENOSINE-5'-DIPHOSPHATE
2FMN1Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1ADP1Ligand/IonADENOSINE-5'-DIPHOSPHATE
2FMN1Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:30 , HIS A:32 , GLY A:33 , ARG A:36 , GLY A:37 , SER A:38 , LYS A:39 , PRO A:44 , THR A:45 , VAL A:97 , HIS A:98 , LEU A:99 , ASP A:106 , PHE A:107 , TYR A:108 , HOH A:170 , TYR B:88BINDING SITE FOR RESIDUE ADP A 164
2AC2SOFTWARETYR A:88 , GLY B:33 , GLY B:35 , ARG B:36 , GLY B:37 , SER B:38 , LYS B:39 , PRO B:44 , THR B:45 , VAL B:97 , HIS B:98 , LEU B:99 , ARG B:102 , ASP B:106 , PHE B:107 , TYR B:108 , HOH B:208 , HOH B:220 , HOH B:241BINDING SITE FOR RESIDUE ADP B 201
3AC3SOFTWAREVAL A:64 , SER A:81 , ARG A:121 , GLU A:123 , LEU A:124 , TYR A:126 , LEU A:132 , ASP A:139BINDING SITE FOR RESIDUE FMN A 165
4AC4SOFTWAREARG B:36 , THR B:45 , ASN B:47 , VAL B:64 , SER B:81 , GLU B:96 , ARG B:121 , GLU B:123 , LEU B:124 , ASN B:125 , LEU B:132BINDING SITE FOR RESIDUE FMN B 202

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1N07)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Ser A:20 -Pro A:21
2Tyr A:22 -Pro A:23
3Ser B:20 -Pro B:21
4Tyr B:22 -Pro B:23

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1N07)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1N07)

(-) Exons   (0, 0)

(no "Exon" information available for 1N07)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:154
 aligned with RIFK_SCHPO | O74866 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:154
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158    
           RIFK_SCHPO     9 RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK 162
               SCOP domains d1n07a_ A: Riboflavin kinase                                                                                                                               SCOP domains
               CATH domains 1n07A00 A:9-162 Riboflavin kinase-like                                                                                                                     CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeeeeeee..............eee.hhhh.........eeeeeeeee..eeeeeeeeeee........eeeeeee...........eeeeeeeeeee......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1n07 A   9 RPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK 162
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158    

Chain B from PDB  Type:PROTEIN  Length:155
 aligned with RIFK_SCHPO | O74866 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:155
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157     
           RIFK_SCHPO     8 KRPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK 162
               SCOP domains d1n07b_ B: Riboflavin kinase                                                                                                                                SCOP domains
               CATH domains 1n07B00 B:8-162 Riboflavin kinase-like                                                                                                                      CATH domains
           Pfam domains (1) -----------Flavokinase-1n07B01 B:19-148                                                                                                      -------------- Pfam domains (1)
           Pfam domains (2) -----------Flavokinase-1n07B02 B:19-148                                                                                                      -------------- Pfam domains (2)
         Sec.struct. author ................eeeeeeee..............eee.hhhh.........eeeeeeee....eeeeeeeeee........eeeeeee...........eeeeeeeeeee......hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1n07 B   8 KRPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYRDSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYIRPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFK 162
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric Unit

(-) Gene Ontology  (14, 14)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (RIFK_SCHPO | O74866)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0008531    riboflavin kinase activity    Catalysis of the reaction: ATP + riboflavin = ADP + FMN + 2 H(+).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0009398    FMN biosynthetic process    The chemical reactions and pathways resulting in the formation of FMN, the oxidized form of flavin mononucleotide (riboflavin 5'-(dihydrogen phosphate)), which acts as a coenzyme for a number of oxidative enzymes including NADH dehydrogenase.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0009231    riboflavin biosynthetic process    The chemical reactions and pathways resulting in the formation of riboflavin (vitamin B2), the precursor for the coenzymes flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD).
    GO:0006771    riboflavin metabolic process    The chemical reactions and pathways involving riboflavin (vitamin B2), the precursor for the coenzymes flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD).
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005743    mitochondrial inner membrane    The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ADP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:20 - Pro A:21   [ RasMol ]  
    Ser B:20 - Pro B:21   [ RasMol ]  
    Tyr A:22 - Pro A:23   [ RasMol ]  
    Tyr B:22 - Pro B:23   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1n07
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RIFK_SCHPO | O74866
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.26
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RIFK_SCHPO | O74866
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RIFK_SCHPO | O748661n05 1n06 1n08

(-) Related Entries Specified in the PDB File

1n05 RIBOFLAVIN KINASE, LIGAND FREE
1n06 RIBOFLAVIN KINASE, ADP-COMPLEX
1n08