1MZG - JenaLib

Title :   X-RAY STRUCTURE OF SUFE FROM E.COLI NORTHEAST STRUCTURAL GENOMICS (NESG) CONSORTIUM TARGET ER30

Authors :   A. Kuzin, W. C. Edstrom, R. Xiao, T. B. Acton, B. Rost, L. Tong, G. T. Montelione, J. F. Hunt, Northeast Structural Genomics Consortium (Nesg)

Date :   07 Oct 02 (Deposition) - 28 Jan 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : A,B

Keywords :   Structural Genomics, Unknown Function, Psi, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Goldsmith-Fischman, A. Kuzin, W. C. Edstrom, J. Benach, R. Shastry, R. Xiao, T. B. Acton, B. Honig, G. T. Montelione, J. F. Hunt
The Sufe Sulfur-Acceptor Protein Contains A Conserved Core Structure That Mediates Interdomain Interactions In A Variety Of Redox Protein Complexes
J. Mol. Biol. V. 344 549 2004
PubMed-ID: 15522304 | Reference-DOI: 10.1016/J.JMB.2004.08.074
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 8)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:144
 aligned with SUFE_ECOLI | P76194 from UniProtKB/Swiss-Prot  Length:138

    Alignment length:144
                                                                                                                                                                 138        
                                    12        22        32        42        52        62        72        82        92       102       112       122       132     |   -    
           SUFE_ECOLI     3 LLPDKEKLLRNFLRCANWEEKYLYIIELGQRLPELRDEDRSPQNSIQGCQSQVWIVMRQNAQGIIELQGDSDAAIVKGLIAVVFILYDQMTPQDIVNFDVRPWFEKMALTQHLTPSRSQGLEAMIRAIRAKAAALS--------   -
               SCOP domains d1mzga_ A: SufE (YhnA)                                                                                                                           SCOP domains
               CATH domains 1mzgA00 A:3-146  [code=3.90.1010.10, no name defined]                                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh.hhhhhhhhhhhhhhhh........hhh.ee......eeeeeee.....eeeeeee.hhhhhhhhhhhhhhh...hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1mzg A   3 LLPDKEKLLRNFLRCANWEEKYLYIIELGQRLPELRDEDRSPQNSIQGCQSQVWIVmRQNAQGIIELQGDSDAAIVKGLIAVVFILYDQmTPQDIVNFDVRPWFEKmALTQHLTPSRSQGLEAmIRAIRAKAAALSLEHHHHHH 146
                                    12        22        32        42        52      | 62        72        82        92       102      |112       122   |   132       142    
                                                                                   59-MSE                           92-MSE          109-MSE          126-MSE

Chain B from PDB  Type:PROTEIN  Length:143
 aligned with SUFE_ECOLI | P76194 from UniProtKB/Swiss-Prot  Length:138

    Alignment length:143
                                                                                                                                                                  138      
                                    11        21        31        41        51        61        71        81        91       101       111       121       131      |  -   
           SUFE_ECOLI     2 ALLPDKEKLLRNFLRCANWEEKYLYIIELGQRLPELRDEDRSPQNSIQGCQSQVWIVMRQNAQGIIELQGDSDAAIVKGLIAVVFILYDQMTPQDIVNFDVRPWFEKMALTQHLTPSRSQGLEAMIRAIRAKAAALS------   -
               SCOP domains d1mzgb_ B: SufE (YhnA)                                                                                                                          SCOP domains
               CATH domains 1mzgB00 B:2-144  [code=3.90.1010.10, no name defined]                                                                                           CATH domains
           Pfam domains (1) --------SufE-1mzgB01 B:10-135                                                                                                         --------- Pfam domains (1)
           Pfam domains (2) --------SufE-1mzgB02 B:10-135                                                                                                         --------- Pfam domains (2)
         Sec.struct. author ....hhhhhhhhhhhh.hhhhhhhhhhhhhhh.............ee......eeeeeee.....eeeeeee.hhhhhhhhhhhhhhhh..hhhhhhh..hhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1mzg B   2 ALLPDKEKLLRNFLRCANWEEKYLYIIELGQRLPELRDEDRSPQNSIQGCQSQVWIVmRQNAQGIIELQGDSDAAIVKGLIAVVFILYDQmTPQDIVNFDVRPWFEKmALTQHLTPSRSQGLEAmIRAIRAKAAALSLEHHHH 144
                                    11        21        31        41        51       |61        71        81        91|      101       111       121    |  131       141   
                                                                                    59-MSE                           92-MSE          109-MSE          126-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (SUFE_ECOLI | P76194)

molecular function
	GO:0008047	enzyme activator activity	Binds to and increases the activity of an enzyme.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0097163	sulfur carrier activity	Enables the directed movement of sulfur into, out of or within a cell, or between cells.
biological process
	GO:0016226	iron-sulfur cluster assembly	The incorporation of iron and exogenous sulfur into a metallo-sulfur cluster.
	GO:0043085	positive regulation of catalytic activity	Any process that activates or increases the activity of an enzyme.
	GO:0006979	response to oxidative stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0006790	sulfur compound metabolic process	The chemical reactions and pathways involving the nonmetallic element sulfur or compounds that contain sulfur, such as the amino acids methionine and cysteine or the tripeptide glutathione.
	GO:0031162	sulfur incorporation into metallo-sulfur cluster	The incorporation of exogenous sulfur into a metallo-sulfur cluster.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1mzg
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SUFE_ECOLI \| P76194
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description