Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR SOLUTION STRUCTURE OF A BOWMAN BIRK INHIBITOR ISOLATED FROM SNAIL MEDIC SEEDS (MEDICAGO SCUTELLATA)
 
Authors :  M. Catalano, L. Ragona, H. Molinari, A. Tava, L. Zetta
Date :  27 Sep 02  (Deposition) - 22 Apr 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (15x)
Keywords :  Serine Protease Inhibitor, Three Stranded Beta-Sheet, Vib Type Turn, Hydrolase Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Catalano, L. Ragona, H. Molinari, A. Tava, L. Zetta
Anticarcinogenic Bowman Birk Inhibitor Isolated From Snail Medic Seeds (Medicago Scutellata): Solution Structure And Analysis Of Self-Association Behaviour
Biochemistry V. 42 2836 2003
PubMed-ID: 12627949  |  Reference-DOI: 10.1021/BI020576W
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BOWMAN-BIRK TYPE PROTEASE INHIBITOR, (MSTI)
    Chains: A
    Organism Scientific: MEDICAGO SCUTELLATA
    Organism Taxid: 36901
    Synonym: MSTI
    Tissue: SEEDS

 Structural Features

(-) Chains, Units

  
NMR Structure (15x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1MVZ)

(-) Sites  (0, 0)

(no "Site" information available for 1MVZ)

(-) SS Bonds  (7, 7)

NMR Structure
No.Residues
1A:8 -A:61
2A:9 -A:24
3A:12 -A:57
4A:14 -A:22
5A:31 -A:38
6A:35 -A:50
7A:40 -A:48

(-) Cis Peptide Bonds  (2, 30)

NMR Structure
No.ModelResidues
11, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15Ile A:18 -Pro A:19
21, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15Phe A:44 -Pro A:45

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1MVZ)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BOWMAN_BIRKPS00281 Bowman-Birk serine protease inhibitors family signature.IBB_MEDSC24-38  1A:24-38

(-) Exons   (0, 0)

(no "Exon" information available for 1MVZ)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:62
 aligned with IBB_MEDSC | P80321 from UniProtKB/Swiss-Prot  Length:62

    Alignment length:62
                                    10        20        30        40        50        60  
             IBB_MEDSC    1 TKSTTTACCDFCPCTRSIPPQCQCTDVREKCHSACKSCLCTRSFPPQCRCYDITDFCYPSCS 62
               SCOP domains d1mvza_ A: Bowman-Birk inhibitor, BBI                          SCOP domains
               CATH domains 1mvzA00 A:1-62                                                 CATH domains
           Pfam domains (1) ---------------------------------Bowman-Birk_leg-1mvzA01  ---- Pfam domains (1)
           Pfam domains (2) ---------------------------------Bowman-Birk_leg-1mvzA02  ---- Pfam domains (2)
         Sec.struct. author ..........................ee.........eee.......eee............ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------BOWMAN_BIRK    ------------------------ PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                  1mvz A  1 TKSTTTACCDFCPCTRSIPPQCQCTDVREKCHSACKSCLCTRSFPPQCRCYDITDFCYPSCS 62
                                    10        20        30        40        50        60
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

NMR Structure
(-)
Clan: no clan defined [family: Bowman-Birk_leg] (11)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (IBB_MEDSC | P80321)
molecular function
    GO:0030414    peptidase inhibitor activity    Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
    GO:0004867    serine-type endopeptidase inhibitor activity    Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
    GO:0010951    negative regulation of endopeptidase activity    Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0010466    negative regulation of peptidase activity    Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1mvz)
 
  Sites
(no "Sites" information available for 1mvz)
 
  Cis Peptide Bonds
    Ile A:18 - Pro A:19   [ RasMol ]  
    Phe A:44 - Pro A:45   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1mvz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IBB_MEDSC | P80321
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IBB_MEDSC | P80321
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IBB_MEDSC | P80321: 2iln

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1MVZ)