Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL STUDIES OF THE RETROVIRAL PROTEINASE FROM AVIAN MYELOBLASTOSIS ASSOCIATED VIRUS
 
Authors :  D. H. Ohlendorf, S. I. Foundling, F. R. Salemme
Date :  07 Sep 90  (Deposition) - 15 Jan 92  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Hydrolase(Aspartic Proteinase) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. H. Ohlendorf, S. I. Foundling, J. J. Wendoloski, J. Sedlacek, P. Strop, F. R. Salemme
Structural Studies Of The Retroviral Proteinase From Avian Myeloblastosis Associated Virus.
Proteins V. 14 382 1992
PubMed-ID: 1332025  |  Reference-DOI: 10.1002/PROT.340140307
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MYELOBLASTOSIS ASSOCIATED VIRAL PROTEASE
    Chains: A, B
    EC Number: 3.4.23.-
    Engineered: YES
    Organism Scientific: AVIAN MYELOBLASTOSIS-ASSOCIATED VIRUS
    Organism Taxid: 11960

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1MVP)

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1ACTAUTHORLEU A:35 , LEU A:36 , ASP A:37 , SER A:38 , GLY A:39 , ALA A:40 , ASP A:41 , ILE A:42 , THR A:43 , ARG A:105 , ILE A:108 , LEU B:35 , LEU B:36 , ASP B:37 , SER B:38 , GLY B:39 , ALA B:40 , ASP B:41 , ILE B:42 , THR B:43 , ARG B:105 , ILE B:108CATALYTIC RESIDUES

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1MVP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1MVP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1MVP)

(-) PROSITE Motifs  (2, 4)

Asymmetric/Biological Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ASP_PROT_RETROVPS50175 Aspartyl protease, retroviral-type family profile.GAG_AVIMA32-113
 		  2A:32-113
B:32-113
2ASP_PROTEASEPS00141 Eukaryotic and viral aspartyl proteases active site.GAG_AVIMA34-45
 		  2A:34-45
B:34-45

(-) Exons   (0, 0)

(no "Exon" information available for 1MVP)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:112
 aligned with GAG_AVIMA | P26315 from UniProtKB/Swiss-Prot  Length:124

    Alignment length:124
                                    10        20        30        40        50        60        70        80        90       100       110       120    
            GAG_AVIMA     1 LAMTMEHKDRPLVRVILTNTGSHPVKQRSVYITALLDSGADITIISEEDWPTDWPVMEAANPQIHGIGGGIPMRKSRDMIEVGVINRDGSLERPLLLFPAVAMVRGSILGRDCLQGLGLRLTNL 124
               SCOP domains d1mvpa_ A: Myeloblastosis-associated viral protease                                                                          SCOP domains
               CATH domains 1mvpA00 A:1-124 Acid Proteases                                                                                               CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) eeeee.....eeeeeeeee........eeeeeeeeee....----hhhhh....eeee.------------.eeee..eeeeeeee..eeeeeeeee.eeee...----hhhhhhhhheeeee. Sec.struct. author (1)
     Sec.struct. author (2) -----------------------------------------eeeee-----------------------------------------------------------eeeee-------------- Sec.struct. author (2)
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------------------ASP_PROT_RETROV  PDB: A:32-113 UniProt: 32-113                                    ----------- PROSITE (1)
                PROSITE (2) ---------------------------------ASP_PROTEASE------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1mvp A   1 LAMTMEHKDRPLVRVILTNTGSHPVKQRSVYITALLDSGADITIISEEDWPTDWPVMEA------------PMRKSRDMIEVGVINRDGSLERPLLLFPAVAMVRGSILGRDCLQGLGLRLTNL 124
                                    10        20        30        40        50        |-         - |      80        90       100       110       120    
                                                                                     59           72                                                    


Chain B from PDB  Type:PROTEIN  Length:111
 aligned with GAG_AVIMA | P26315 from UniProtKB/Swiss-Prot  Length:124

    Alignment length:124
                                    10        20        30        40        50        60        70        80        90       100       110       120    
            GAG_AVIMA     1 LAMTMEHKDRPLVRVILTNTGSHPVKQRSVYITALLDSGADITIISEEDWPTDWPVMEAANPQIHGIGGGIPMRKSRDMIEVGVINRDGSLERPLLLFPAVAMVRGSILGRDCLQGLGLRLTNL 124
               SCOP domains d1mvpb_ B: Myeloblastosis-associated viral protease                                                                          SCOP domains
               CATH domains 1mvpB00 B:1-124 Acid Proteases                                                                                               CATH domains
           Pfam domains (1) -----RVP-1mvpB01 B:6-122                                                                                                  -- Pfam domains (1)
           Pfam domains (2) -----RVP-1mvpB02 B:6-122                                                                                                  -- Pfam domains (2)
     Sec.struct. author (1) eeeee.....eeeeeeeee........eeeeeeeeee....----hhhhh....eeee-------------.eeee..eeeeeeee..eeeeeeeee.eeee...----hhhhhhhhheeeee. Sec.struct. author (1)
     Sec.struct. author (2) -----------------------------------------eeeee-----------------------------------------------------------eeeee-------------- Sec.struct. author (2)
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------------------ASP_PROT_RETROV  PDB: B:32-113 UniProt: 32-113                                    ----------- PROSITE (1)
                PROSITE (2) ---------------------------------ASP_PROTEASE------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------- Transcript
                 1mvp B   1 LAMTMEHKDRPLVRVILTNTGSHPVKQRSVYITALLDSGADITIISEEDWPTDWPVME-------------PMRKSRDMIEVGVINRDGSLERPLLLFPAVAMVRGSILGRDCLQGLGLRLTNL 124
                                    10        20        30        40        50       | -         - |      80        90       100       110       120    
                                                                                    58            72
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Peptidase_AA (368)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (GAG_AVIMA | P26315)
molecular function
    GO:0004190    aspartic-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
biological process
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1mvp)
 
  Sites
    ACT  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1mvp)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1mvp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GAG_AVIMA | P26315
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.23.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GAG_AVIMA | P26315
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GAG_AVIMA | P26315: 2mvp

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1MVP)