1MMF - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF SUBSTRATE FREE FORM OF GLYCEROL DEHYDRATASE

Authors :   D. I. Liao, G. Dotson, I. Turner, L. Reiss, M. Emptage

Date :   03 Sep 02 (Deposition) - 10 Jun 03 (Release) - 24 Oct 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym. Unit : A,B,E,G,L,M
Biol. Unit 1: A,B,G  (1x)
Biol. Unit 2: E,L,M  (1x)
Biol. Unit 3: A,B,E,G,L,M  (1x)

Keywords :   Glycerol Dehydratase, Diol Dehydratase, Coenzyme B12, Tim Barrel, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. I. Liao, G. Dotson, I. Turner, L. Reiss, M. Emptage
Crystal Structure Of Substrate Free Form Of Glycerol Dehydratase
J. Inorg. Biochem. V. 93 84 2003
PubMed-ID: 12538056 | Reference-DOI: 10.1016/S0162-0134(02)00523-8

Molecule 1 - GLYCEROL DEHYDRASE ALPHA SUBUNIT
	Chains	:	A, L
	EC Number	:	4.2.1.30
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PBLUESCRIPT SKII
	Expression System Strain	:	BL21DE3
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	KLEBSIELLA PNEUMONIAE
	Organism Taxid	:	573
	Synonym	:	GLYCEROL DEHYDRATASE ALPHA SUBUNIT

Molecule 2 - GLYCEROL DEHYDRASE BETA SUBUNIT
	Chains	:	B, E
	EC Number	:	4.2.1.30
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PBLUESCRIPT SKII
	Expression System Strain	:	BL21DE3
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	KLEBSIELLA PNEUMONIAE
	Organism Taxid	:	573
	Synonym	:	GLYCEROL DEHYDRATASE BETA SUBUNIT

Molecule 3 - GLYCEROL DEHYDRASE GAMMA SUBUNIT
	Chains	:	G, M
	EC Number	:	4.2.1.30
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PBLUESCRIPT SKII
	Expression System Strain	:	BL21DE3
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Organism Scientific	:	KLEBSIELLA PNEUMONIAE
	Organism Taxid	:	573
	Synonym	:	GLYCEROL DEHYDRATASE GAMMA SUBUNIT

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	E	G	L	M
Biological Unit 1 (1x)	:	A	B		G
Biological Unit 2 (1x)	:			E		L	M
Biological Unit 3 (1x)	:	A	B	E	G	L	M

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 4)

No.	Name	Count	Type	Full Name
1	B12	2	Ligand/Ion	COBALAMIN
2	K	2	Ligand/Ion	POTASSIUM ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	B12	1	Ligand/Ion	COBALAMIN
2	K	-1	Ligand/Ion	POTASSIUM ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	B12	1	Ligand/Ion	COBALAMIN
2	K	-1	Ligand/Ion	POTASSIUM ION

Biological Unit 3 (1, 2)

No.	Name	Count	Type	Full Name
1	B12	2	Ligand/Ion	COBALAMIN
2	K	-1	Ligand/Ion	POTASSIUM ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLN A:142 , GLU A:171 , GLU A:222 , GLN A:297 , SER A:363 , HOH A:1006	BINDING SITE FOR RESIDUE K A 1001
2	AC2	SOFTWARE	GLN L:142 , GLU L:171 , GLU L:222 , GLN L:297 , SER L:363 , HOH L:1006	BINDING SITE FOR RESIDUE K L 1002
3	AC3	SOFTWARE	THR A:173 , VAL A:174 , GLY A:175 , SER A:203 , GLU A:206 , THR A:223 , ASP A:235 , LEU A:268 , MET A:269 , GLN A:337 , MET A:374 , PHE A:375 , ASP B:79 , SER B:81 , LYS B:102 , THR B:104 , LEU B:115 , ASN B:117 , LEU B:120 , SER B:122 , GLN B:123 , ALA B:124 , ARG B:160 , PHE B:163 , MET B:164	BINDING SITE FOR RESIDUE B12 B 601
4	AC4	SOFTWARE	ASP E:79 , SER E:81 , LYS E:102 , THR E:104 , VAL E:106 , LEU E:115 , ASN E:117 , LEU E:120 , SER E:122 , GLN E:123 , ALA E:124 , ARG E:160 , PHE E:163 , HOH E:607 , HOH E:610 , THR L:173 , SER L:203 , GLU L:206 , THR L:223 , ASP L:235 , LEU L:268 , MET L:269 , SER L:302 , GLN L:337 , MET L:374 , PHE L:375 , ALA L:376 , HOH L:1050	BINDING SITE FOR RESIDUE B12 E 602

(no "SS Bond" information available for 1MMF)

Asymmetric Unit

No.	Residues
1	Tyr G:11	-	Pro G:12

(no "SAP(SNP)/Variant" information available for 1MMF)

(no "PROSITE Motif" information available for 1MMF)

(no "Exon" information available for 1MMF)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:552
 aligned with Q59476_KLEPN | Q59476 from UniProtKB/TrEMBL  Length:555

    Alignment length:552
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550  
         Q59476_KLEPN     1 MKRSKRFAVLAQRPVNQDGLIGEWPEEGLIAMDSPFDPVSSVKVDNGLIVELDGKRRDQFDMIDRFIADYAINVERTEQAMRLEAVEIARMLVDIHVSREEIIAITTAITPAKAVEVMAQMNVVEMMMALQKMRARRTPSNQCHVTNLKDNPVQIAADAAEAGIRGFSEQETTVGIARYAPFNALALLVGSQCGRPGVLTQCSVEEATELELGMRGLTSYAETVSVYGTEAVFTDGDDTPWSKAFLASAYASRGLKMRYTSGTGSEALMGYSESKSMLYLESRCIFITKGAGVQGLQNGAVSCIGMTGAVPSGIRAVLAENLIASMLDLEVASANDQTFSHSDIRRTARTLMQMLPGTDFIFSGYSAVPNYDNMFAGSNFDAEDFDDYNILQRDLMVDGGLRPVTEAETIAIRQKAARAIQAVFRELGLPPIADEEVEAATYAHGSNEMPPRNVVEDLSAVEEMMKRNITGLDIVGALSRSGFEDIASNILNMLRQRVTGDYLQTSAILDRQFEVVSAVNDINDYQGPGTGYRISAERWAEIKNIPGVVQPD 552
               SCOP domains d1mmfa_ A: Diol dehydratase, alpha subunit                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains 1mmfA00 A:1-552  [code=3.20.20.350, no name defined]                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhh.....hhhhh.............eeee..eeeee..ee.hhhhhhhhhhhhhh.hhhhhhhhh..hhhhhhhhhhh...hhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhh..eeee...hhhhhhhhhhhhhhhhhhhh...eeee..hhhhhhhhhhh....eeeeee...hhhhhhhh..hhhhhhhhhhhhhh...eeeee...hhhhhh......hhhhhhhhhhhhhhhhh..eee..hhhhhhhhh...hhhhhhhhhhhhhhhh..eee.........hhhhhhhhhhhhhh....eeeeeee..hhhhh.......hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhh.hhhhh...hhhhhhhhhhhhhhhh.hhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh...ee.....ee..................hhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1mmf A   1 MKRSKRFAVLAQRPVNQDGLIGEWPEEGLIAMDSPFDPVSSVKVDNGLIVELDGKRRDQFDMIDRFIADYAINVERTEQAMRLEAVEIARMLVDIHVSREEIIAITTAITPAKAVEVMAQMNVVEMMMALQKMRARRTPSNQCHVTNLKDNPVQIAADAAEAGIRGFSEQETTVGIARYAPFNALALLVGSQCGRPGVLTQCSVEEATELELGMRGLTSYAETVSVYGTEAVFTDGDDTPWSKAFLASAYASRGLKMRYTSGTGSEALMGYSESKSMLYLESRCIFITKGAGVQGLQNGAVSCIGMTGAVPSGIRAVLAENLIASMLDLEVASANDQTFSHSDIRRTARTLMQMLPGTDFIFSGYSAVPNYDNMFAGSNFDAEDFDDYNILQRDLMVDGGLRPVTEAETIAIRQKAARAIQAVFRELGLPPIADEEVEAATYAHGSNEMPPRNVVEDLSAVEEMMKRNITGLDIVGALSRSGFEDIASNILNMLRQRVTGDYLQTSAILDRQFEVVSAVNDINDYQGPGTGYRISAERWAEIKNIPGVVQPD 552
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550

Chain B from PDB  Type:PROTEIN  Length:181
 aligned with O08505_KLEPN | O08505 from UniProtKB/TrEMBL  Length:194

    Alignment length:181
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190 
         O08505_KLEPN    11 FTLKTREGGVASADERADEVVIGVGPAFDKHQHHTLIDMPHGAILKELIAGVEEEGLHARVVRILRTSDVSFMAWDAANLSGSGIGIGIQSKGTTVIHQRDLLPLSNLELFSQAPLLTLETYRQIGKNAARYARKESPSPVPVVNDQMVRPKFMAKAALFHIKETKHVVQDAEPVTLHIDL 191
               SCOP domains d1mmfb_ B: Diol dehydratase, beta subunit                                                                                                                                             SCOP domains
               CATH domains 1mmfB00 B:11-191 Diol Dehydratase; Chain B                                                                                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee...........eeeeee...............hhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhh.....eeeee.....eeeee.........eee.hhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhh......eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1mmf B  11 FTLKTREGGVASADERADEVVIGVGPAFDKHQHHTLIDMPHGAILKELIAGVEEEGLHARVVRILRTSDVSFMAWDAANLSGSGIGIGIQSKGTTVIHQRDLLPLSNLELFSQAPLLTLETYRQIGKNAARYARKESPSPVPVVNDQMVRPKFMAKAALFHIKETKHVVQDAEPVTLHIDL 191
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190

Chain E from PDB  Type:PROTEIN  Length:184
 aligned with O08505_KLEPN | O08505 from UniProtKB/TrEMBL  Length:194

    Alignment length:184
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189    
         O08505_KLEPN    10 SFTLKTREGGVASADERADEVVIGVGPAFDKHQHHTLIDMPHGAILKELIAGVEEEGLHARVVRILRTSDVSFMAWDAANLSGSGIGIGIQSKGTTVIHQRDLLPLSNLELFSQAPLLTLETYRQIGKNAARYARKESPSPVPVVNDQMVRPKFMAKAALFHIKETKHVVQDAEPVTLHIDLVR 193
               SCOP domains d1mmfe_ E: Diol dehydratase, beta subunit                                                                                                                                                SCOP domains
               CATH domains 1mmfE00 E:10-193 Diol Dehydratase; Chain B                                                                                                                                               CATH domains
           Pfam domains (1) ------------------------Dehydratase_MU-1mmfE01 E:34-153                                                                                         ---------------------------------------- Pfam domains (1)
           Pfam domains (2) ------------------------Dehydratase_MU-1mmfE02 E:34-153                                                                                         ---------------------------------------- Pfam domains (2)
         Sec.struct. author ..eeeeeeeee........eeeeee...............hhhhhhhhhhhhhhhh..eeeeee.....hhhhhhhhhhh.....eeeee.....eeeee.........eee.hhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhh.......eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1mmf E  10 SFTLKTREGGVASADERADEVVIGVGPAFDKHQHHTLIDMPHGAILKELIAGVEEEGLHARVVRILRTSDVSFMAWDAANLSGSGIGIGIQSKGTTVIHQRDLLPLSNLELFSQAPLLTLETYRQIGKNAARYARKESPSPVPVVNDQMVRPKFMAKAALFHIKETKHVVQDAEPVTLHIDLVR 193
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189

Chain G from PDB  Type:PROTEIN  Length:132
 aligned with Q59475_KLEPN | Q59475 from UniProtKB/TrEMBL  Length:141

    Alignment length:132
                                    19        29        39        49        59        69        79        89        99       109       119       129       139  
         Q59475_KLEPN    10 DYPLATRCPEHILTPTGKPLTDITLEKVLSGEVGPQDVRISRQTLEYQAQIAEQMQRHAVARNFRRAAELIAIPDERILAIYNALRPFRSSQAELLAIADELEHTWHATVNAAFVRESAEVYQQRHKLRKGS 141
               SCOP domains d1mmfg_ G: Diol dehydratase, gamma subunit                                                                                           SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......hhhhh......hhhhhhhhhhhh..........hhhhhhhhhhhhhh..hhhhhhhhhhhhh....hhhhhhhhhhhhh....hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1mmf G  10 DYPLATRCPEHILTPTGKPLTDITLEKVLSGEVGPQDVRISRQTLEYQAQIAEQMQRHAVARNFRRAAELIAIPDERILAIYNALRPFRSSQAELLAIADELEHTWHATVNAAFVRESAEVYQQRHKLRKGS 141
                                    19        29        39        49        59        69        79        89        99       109       119       129       139

Chain L from PDB  Type:PROTEIN  Length:555
 aligned with Q59476_KLEPN | Q59476 from UniProtKB/TrEMBL  Length:555

    Alignment length:555
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550     
         Q59476_KLEPN     1 MKRSKRFAVLAQRPVNQDGLIGEWPEEGLIAMDSPFDPVSSVKVDNGLIVELDGKRRDQFDMIDRFIADYAINVERTEQAMRLEAVEIARMLVDIHVSREEIIAITTAITPAKAVEVMAQMNVVEMMMALQKMRARRTPSNQCHVTNLKDNPVQIAADAAEAGIRGFSEQETTVGIARYAPFNALALLVGSQCGRPGVLTQCSVEEATELELGMRGLTSYAETVSVYGTEAVFTDGDDTPWSKAFLASAYASRGLKMRYTSGTGSEALMGYSESKSMLYLESRCIFITKGAGVQGLQNGAVSCIGMTGAVPSGIRAVLAENLIASMLDLEVASANDQTFSHSDIRRTARTLMQMLPGTDFIFSGYSAVPNYDNMFAGSNFDAEDFDDYNILQRDLMVDGGLRPVTEAETIAIRQKAARAIQAVFRELGLPPIADEEVEAATYAHGSNEMPPRNVVEDLSAVEEMMKRNITGLDIVGALSRSGFEDIASNILNMLRQRVTGDYLQTSAILDRQFEVVSAVNDINDYQGPGTGYRISAERWAEIKNIPGVVQPDTIE 555
               SCOP domains d1mmfl_ L: Diol dehydratase, alpha subunit                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains 1mmfL00 L:1-555  [code=3.20.20.350, no name defined]                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        CATH domains
           Pfam domains (1) -Dehydratase_LU-1mmfL01 L:2-555                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             Pfam domains (1)
           Pfam domains (2) -Dehydratase_LU-1mmfL02 L:2-555                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhhhhh.....hhhhh.............eeee..eeeee..ee.hhhhhhhhhhhhhh....hhhhhh..hhhhhhhhhhh...hhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhh..eeee...hhhhhhhhhhhhhhhhhhhh...eeee..hhhhhhhhhhh....eeeeee...hhhhhhhh..hhhhhhhhhhhhhh...eeeee...hhhhhh......hhhhhhhhhhhhhhhhh..eee..hhhhhhhhh...hhhhhhhhhhhhhhhh..eee.........hhhhhhhhhhhhhh....eeeeeee..hhhhh.......hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh.hhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh...ee.....ee..................hhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1mmf L   1 MKRSKRFAVLAQRPVNQDGLIGEWPEEGLIAMDSPFDPVSSVKVDNGLIVELDGKRRDQFDMIDRFIADYAINVERTEQAMRLEAVEIARMLVDIHVSREEIIAITTAITPAKAVEVMAQMNVVEMMMALQKMRARRTPSNQCHVTNLKDNPVQIAADAAEAGIRGFSEQETTVGIARYAPFNALALLVGSQCGRPGVLTQCSVEEATELELGMRGLTSYAETVSVYGTEAVFTDGDDTPWSKAFLASAYASRGLKMRYTSGTGSEALMGYSESKSMLYLESRCIFITKGAGVQGLQNGAVSCIGMTGAVPSGIRAVLAENLIASMLDLEVASANDQTFSHSDIRRTARTLMQMLPGTDFIFSGYSAVPNYDNMFAGSNFDAEDFDDYNILQRDLMVDGGLRPVTEAETIAIRQKAARAIQAVFRELGLPPIADEEVEAATYAHGSNEMPPRNVVEDLSAVEEMMKRNITGLDIVGALSRSGFEDIASNILNMLRQRVTGDYLQTSAILDRQFEVVSAVNDINDYQGPGTGYRISAERWAEIKNIPGVVQPDTIE 555
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550

Chain M from PDB  Type:PROTEIN  Length:131
 aligned with Q59475_KLEPN | Q59475 from UniProtKB/TrEMBL  Length:141

    Alignment length:131
                                    20        30        40        50        60        70        80        90       100       110       120       130       140 
         Q59475_KLEPN    11 YPLATRCPEHILTPTGKPLTDITLEKVLSGEVGPQDVRISRQTLEYQAQIAEQMQRHAVARNFRRAAELIAIPDERILAIYNALRPFRSSQAELLAIADELEHTWHATVNAAFVRESAEVYQQRHKLRKGS 141
               SCOP domains d1mmfm_ M: Diol dehydratase, gamma subunit                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) Dehydratase_SU-1mmfM01 M:11-138                                                                                                 --- Pfam domains (1)
           Pfam domains (2) Dehydratase_SU-1mmfM02 M:11-138                                                                                                 --- Pfam domains (2)
         Sec.struct. author .................hhhhhhhhhhhh..........hhhhhhhhhhhhhhh.hhhhhhhhhhhhh....hhhhhhhhhhhhh....hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1mmf M  11 YPLATRCPEHILTPTGKPLTDITLEKVLSGEVGPQDVRISRQTLEYQAQIAEQMQRHAVARNFRRAAELIAIPDERILAIYNALRPFRSSQAELLAIADELEHTWHATVNAAFVRESAEVYQQRHKLRKGS 141
                                    20        30        40        50        60        70        80        90       100       110       120       130       140

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: Diol Dehydratase; Chain B (11)

Klebsiella pneumoniae. Organism_taxid: 573. (1)

1a	1mmfB00	B:11-191
1b	1mmfE00	E:10-193

Architecture: Alpha-Beta Barrel (2994)

Topology: TIM Barrel (2806)

Homologous Superfamily: [code=3.20.20.350, no name defined] (9)

Klebsiella pneumoniae. Organism_taxid: 573. (1)

2a	1mmfA00	A:1-552
2b	1mmfL00	L:1-555

Asymmetric Unit(hide GO term definitions)

Chain A,L (Q59476_KLEPN | Q59476)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0031419	cobalamin binding	Interacting selectively and non-covalently with cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
	GO:0046405	glycerol dehydratase activity	Catalysis of the reaction: glycerol = 3-hydroxypropanal + H2O.
	GO:0016836	hydro-lyase activity	Catalysis of the cleavage of a carbon-oxygen bond by elimination of water.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
	GO:0050215	propanediol dehydratase activity	Catalysis of the reaction: propane-1,2-diol = H(2)O + propanal.
biological process
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

Chain B,E (O08505_KLEPN | O08505)

molecular function
	GO:0046405		glycerol dehydratase activity		Catalysis of the reaction: glycerol = 3-hydroxypropanal + H2O.
	GO:0016829		lyase activity		Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.

Chain G,M (Q59475_KLEPN | Q59475)

molecular function
	GO:0046405		glycerol dehydratase activity		Catalysis of the reaction: glycerol = 3-hydroxypropanal + H2O.
	GO:0016829		lyase activity		Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		B12	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		K	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Tyr G:11 - Pro G:12	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1mmf
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	O08505_KLEPN \| O08505
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL
	Q59475_KLEPN \| Q59475
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL
	Q59476_KLEPN \| Q59476
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	4.2.1.30
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	O08505_KLEPN \| O08505
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q59475_KLEPN \| Q59475
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	Q59476_KLEPN \| Q59476
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/TrEMBL
	O08505_KLEPN \| O08505	:	1iwp
	Q59475_KLEPN \| Q59475	:	1iwp
	Q59476_KLEPN \| Q59476	:	1iwp

(no "Related Entries Specified in the PDB File" available for 1MMF)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 6)

CATH Domains (2, 4)

Pfam Domains (3, 6)

Gene Ontology (7, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File