Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF A BRCA2-DSS1 COMPLEX
 
Authors :  H. Yang, P. D. Jeffrey, J. Miller, E. Kinnucan, Y. Sun, N. H. Thoma, N. Zheng, P. L. Chen, W. H. Lee, N. P. Pavletich
Date :  23 Aug 02  (Deposition) - 25 Sep 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.10
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A,B  (4x)
Keywords :  Tumor Suppressor, Breast Cancer Susceptibility, Dna-Binding, Gene Regulation/Antitumor Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Yang, P. D. Jeffrey, J. Miller, E. Kinnucan, Y. Sun, N. H. Thoma, N. Zheng, P. L. Chen, W. H. Lee, N. P. Pavletich
Brca2 Function In Dna Binding And Recombination From A Brca2-Dss1-Ssdna Structure
Science V. 297 1837 2002
PubMed-ID: 12228710  |  Reference-DOI: 10.1126/SCIENCE.297.5588.1837
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DELETED IN SPLIT HAND/SPLIT FOOT PROTEIN 1
    ChainsB
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System CommonFALL ARMYWORM
    Expression System Taxid7108
    Expression System VectorPACG2T
    Expression System Vector TypeBACULOVIRUS
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymDSS1, SPLIT HAND/FOOT DELETED PROTEIN 1
 
Molecule 2 - BREAST CANCER TYPE 2 SUSCEPTIBILITY PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System CommonFALL ARMYWORM
    Expression System Taxid7108
    Expression System VectorPACG2T
    Expression System Vector TypeBACULOVIRUS
    FragmentRESIDUES 2378-3115
    Organism CommonHOUSE MOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    SynonymBRCA2

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)AB
Biological Unit 2 (4x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 5)

Asymmetric Unit (1, 5)
No.NameCountTypeFull Name
1HG5Ligand/IonMERCURY (II) ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1HG-1Ligand/IonMERCURY (II) ION
Biological Unit 2 (0, 0)
No.NameCountTypeFull Name
1HG-1Ligand/IonMERCURY (II) ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:2597 , ASP A:2684 , ALA A:2685 , CYS A:2686 , LEU A:2695BINDING SITE FOR RESIDUE HG A 101
2AC2SOFTWARECYS A:3045BINDING SITE FOR RESIDUE HG A 102
3AC3SOFTWAREPRO A:2987 , CYS A:2988BINDING SITE FOR RESIDUE HG A 103
4AC4SOFTWARECYS A:2567 , LEU B:10BINDING SITE FOR RESIDUE HG A 104
5AC5SOFTWARECYS A:3016BINDING SITE FOR RESIDUE HG A 105

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1MIU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1MIU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (13, 13)

Asymmetric Unit (13, 13)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_012003D17GSEM1_HUMANPolymorphism1802882BD17G
02UniProtVAR_BRCA2_MOUSE_017 *K2605QBRCA2_MOUSE  ---  ---AK2605Q
03UniProtVAR_BRCA2_MOUSE_018 *A2648PBRCA2_MOUSE  ---  ---AA2648P
04UniProtVAR_BRCA2_MOUSE_019 *R2717CBRCA2_MOUSE  ---  ---AR2717C
05UniProtVAR_BRCA2_MOUSE_020 *L2729MBRCA2_MOUSE  ---  ---AL2729M
06UniProtVAR_BRCA2_MOUSE_021 *Q2814HBRCA2_MOUSE  ---  ---AQ2814H
07UniProtVAR_BRCA2_MOUSE_022 *A2827PBRCA2_MOUSE  ---  ---AA2827P
08UniProtVAR_BRCA2_MOUSE_023 *S2907IBRCA2_MOUSE  ---  ---AS2907I
09UniProtVAR_BRCA2_MOUSE_024 *H2929LBRCA2_MOUSE  ---  ---AH2929L
10UniProtVAR_BRCA2_MOUSE_025 *A3058GBRCA2_MOUSE  ---  ---AA3058G
11UniProtVAR_BRCA2_MOUSE_026 *A3071GBRCA2_MOUSE  ---  ---AA3071G
12UniProtVAR_BRCA2_MOUSE_027 *K3081EBRCA2_MOUSE  ---  ---AK3081E
13UniProtVAR_BRCA2_MOUSE_028 *T3089SBRCA2_MOUSE  ---  ---AT3089S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (13, 13)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_012003D17GSEM1_HUMANPolymorphism1802882BD17G
02UniProtVAR_BRCA2_MOUSE_017 *K2605QBRCA2_MOUSE  ---  ---AK2605Q
03UniProtVAR_BRCA2_MOUSE_018 *A2648PBRCA2_MOUSE  ---  ---AA2648P
04UniProtVAR_BRCA2_MOUSE_019 *R2717CBRCA2_MOUSE  ---  ---AR2717C
05UniProtVAR_BRCA2_MOUSE_020 *L2729MBRCA2_MOUSE  ---  ---AL2729M
06UniProtVAR_BRCA2_MOUSE_021 *Q2814HBRCA2_MOUSE  ---  ---AQ2814H
07UniProtVAR_BRCA2_MOUSE_022 *A2827PBRCA2_MOUSE  ---  ---AA2827P
08UniProtVAR_BRCA2_MOUSE_023 *S2907IBRCA2_MOUSE  ---  ---AS2907I
09UniProtVAR_BRCA2_MOUSE_024 *H2929LBRCA2_MOUSE  ---  ---AH2929L
10UniProtVAR_BRCA2_MOUSE_025 *A3058GBRCA2_MOUSE  ---  ---AA3058G
11UniProtVAR_BRCA2_MOUSE_026 *A3071GBRCA2_MOUSE  ---  ---AA3071G
12UniProtVAR_BRCA2_MOUSE_027 *K3081EBRCA2_MOUSE  ---  ---AK3081E
13UniProtVAR_BRCA2_MOUSE_028 *T3089SBRCA2_MOUSE  ---  ---AT3089S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (13, 52)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_012003D17GSEM1_HUMANPolymorphism1802882BD17G
02UniProtVAR_BRCA2_MOUSE_017 *K2605QBRCA2_MOUSE  ---  ---AK2605Q
03UniProtVAR_BRCA2_MOUSE_018 *A2648PBRCA2_MOUSE  ---  ---AA2648P
04UniProtVAR_BRCA2_MOUSE_019 *R2717CBRCA2_MOUSE  ---  ---AR2717C
05UniProtVAR_BRCA2_MOUSE_020 *L2729MBRCA2_MOUSE  ---  ---AL2729M
06UniProtVAR_BRCA2_MOUSE_021 *Q2814HBRCA2_MOUSE  ---  ---AQ2814H
07UniProtVAR_BRCA2_MOUSE_022 *A2827PBRCA2_MOUSE  ---  ---AA2827P
08UniProtVAR_BRCA2_MOUSE_023 *S2907IBRCA2_MOUSE  ---  ---AS2907I
09UniProtVAR_BRCA2_MOUSE_024 *H2929LBRCA2_MOUSE  ---  ---AH2929L
10UniProtVAR_BRCA2_MOUSE_025 *A3058GBRCA2_MOUSE  ---  ---AA3058G
11UniProtVAR_BRCA2_MOUSE_026 *A3071GBRCA2_MOUSE  ---  ---AA3071G
12UniProtVAR_BRCA2_MOUSE_027 *K3081EBRCA2_MOUSE  ---  ---AK3081E
13UniProtVAR_BRCA2_MOUSE_028 *T3089SBRCA2_MOUSE  ---  ---AT3089S
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1MIU)

(-) Exons   (3, 3)

Asymmetric Unit (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002485661aENSE00001039676chr7:96339203-96339000204SEM1_HUMAN1-26261B:7-2519
1.4bENST000002485664bENSE00000877478chr7:96324203-9632411094SEM1_HUMAN26-57321B:37-57 (gaps)21
1.5bENST000002485665bENSE00001895287chr7:96318278-96317770509SEM1_HUMAN57-70141B:57-637

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:671
 aligned with BRCA2_MOUSE | P97929 from UniProtKB/Swiss-Prot  Length:3329

    Alignment length:705
                                  2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608      2618      2628      2638      2648      2658      2668      2678      2688      2698      2708      2718      2728      2738      2748      2758      2768      2778      2788      2798      2808      2818      2828      2838      2848      2858      2868      2878      2888      2898      2908      2918      2928      2938      2948      2958      2968      2978      2988      2998      3008      3018      3028      3038      3048      3058      3068      3078      3088      3098     
         BRCA2_MOUSE   2399 KDLMSSLQSARDLQDMRIKNKERRHLRLQPGSLYLTKSSTLPRISLQAAVGDRAPSACSPKQLYIYGVSKECINVNSKNAEYFQFDIQDHFGKEDLCAGKGFQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISSIWVANHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYRYDVEIDNSRRSALKKILERDDTAAKTLVLCISDIISPSTKVSETSGGKTSGEDANKVDTIELTDGWYAVRAQLDPPLMALVKSGKLTVGQKIITQGAELVGSPDACAPLEAPDSLRLKISANSTRPARWHSRLGFFRDPRPFPLPLSSLFSDGGNVGCVDIIVQRVYPLQWVEKTVSGLYIFRSEREEEKEALRFAEAQQKKLEALFTKVHTEFKDHEEDTTQRCVLSRTLTRQQVHALQDGAELYAAVQYASDPDHLEACFSEEQLRALNNYRQMLNDKKQARIQSEFRKALESAEKEEGLSRDVTTVWKLRVTSYKKKEKSALLSIWRPSSDLSSLLTEGKRYRIYHLAVSKSKSKFERPSIQLTATKRTQYQQLPVSSETLLQVYQPRESLHFSRLSDPAFQPPCSEVDVVGVVVSVVKPIGLAPLVYLSDECLNLLVVKFGIDLNEDIKPRVLIAASNLQCQPESTSGVPTLFAGHFSIFSASPKEAYFQEKVNNLKHAIENIDTFYKEAEKKLIHVLE 3103
               SCOP domains d1miua1 A:2399-2589 BRCA2 helical domain                                                                                                                                                       d1miua3 A:2590-2722 OB-fo                      ld domains of BRCA2                                                                   d1miua4                      d1miua2 A:2752-2887 BRCA2 tower domain                                                                                                  d1miua4 A:2723-2751,A:2888-2970 OB-fold domains of BRCA2                           d1miua5 A:2971-3103 OB-fold domains of BRCA2                                                                                          SCOP domains
               CATH domains -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1miuA02 A:2590-2719 Nucle                      ic acid-binding proteins                                                           1miuA03 A:2720-2752,A:2887-2970  -------------------------------------------            -------------------------------------------------------------------------------1miuA03 A:2720-2752,A:2887-2970 Nucleic acid-binding proteins                       ------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -BRCA-2_helical-1miuA03 A:2400-2588                                                                                                                                                           --BRCA-2_OB1-1miuA01 A:259                      1-2721                                                                               ------------------------------Tower-1miuA04 A:2752-2793                 --            -------------------------------------------------------------------------------------------------------------------------------------------------------------------BRCA-2_OB3-1miuA02 A:2971-3103                                                                                                        Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhh.......hhhhhhhh.....ee.hhhhh...................................hhhhhh.........ee.....ee........hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhh.....hhhhhhhh........ee.ee...----------------------.....ee....ee....hhhhhhhhhh...............ee...............ee..hhhhh.........ee.........hhhhh......eeeeeeeeeee......ee.....ee....hhhhhhhhhhhhhh.hhhhhhhhhhhh...------------....hhhhhhh..hhhhhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhh...........eeeeeeee.......eeeeee..hhhhhhhh....eeeeeee..............eeeeeeeeeeeee..hhhhhh..........hhhhhh........eeeeeeeeeeee.......eeeee.....eeeeee............eeeeeeee...........eee....eee.......hhhhhhhhhhhhhh..hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Q------------------------------------------P--------------------------------------------------------------------C-----------M------------------------------------------------------------------------------------H------------P-------------------------------------------------------------------------------I---------------------L--------------------------------------------------------------------------------------------------------------------------------G------------G---------E-------S-------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1miu A 2399 KDLMSSLQSARDLQDMRIKNKERRHLRLQPGSLYLTKSSTLPRISLQAAVGDRAPSACSPKQLYIYGVSKECINVNSKNAEYFQFDIQDHFGKEDLCAGKGFQLADGGWLIPSNDGKAGKEEFYRALCDTPGVDPKLISSIWVANHYRWIVWKLAAMEFAFPKEFANRCLNPERVLLQLKYRYDVEIDNSRRSALKKILERDDTAAKTLVLCISDI----------------------VDTIELTDGWYAVRAQLDPPLMALVKSGKLTVGQKIITQGAELVGSPDACAPLEAPDSLRLKISANSTRPARWHSRLGFFRDPRPFPLPLSSLFSDGGNVGCVDIIVQRVYPLQWVEKTVSGLYIFRSEREEEKEALRFAEAQQKKLEALFTKVHTEFK------------SRTLTRQQVHALQDGAELYAAVQYASDPDHLEACFSEEQLRALNNYRQMLNDKKQARIQSEFRKALESAEKEEGLSRDVTTVWKLRVTSYKKKEKSALLSIWRPSSDLSSLLTEGKRYRIYHLAVSKSKSKFERPSIQLTATKRTQYQQLPVSSETLLQVYQPRESLHFSRLSDPAFQPPCSEVDVVGVVVSVVKPIGLAPLVYLSDECLNLLVVKFGIDLNEDIKPRVLIAASNLQCQPESTSGVPTLFAGHFSIFSASPKEAYFQEKVNNLKHAIENIDTFYKEAEKKLIHVLE 3103
                                  2408      2418      2428      2438      2448      2458      2468      2478      2488      2498      2508      2518      2528      2538      2548      2558      2568      2578      2588      2598      2608     |   -         -      2638      2648      2658      2668      2678      2688      2698      2708      2718      2728      2738      2748      2758      2768      2778      2788      |  -      2808      2818      2828      2838      2848      2858      2868      2878      2888      2898      2908      2918      2928      2938      2948      2958      2968      2978      2988      2998      3008      3018      3028      3038      3048      3058      3068      3078      3088      3098     
                                                                                                                                                                                                                                                2614                   2637                                                                                                                                                          2795         2808                                                                                                                                                                                                                                                                                                       

Chain B from PDB  Type:PROTEIN  Length:42
 aligned with SEM1_HUMAN | P60896 from UniProtKB/Swiss-Prot  Length:70

    Alignment length:57
                                    16        26        36        46        56       
          SEM1_HUMAN      7 PVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKH   63
               SCOP domains --------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhh.ee...........-----------.........----........hhhhhh Sec.struct. author
                 SAPs(SNPs) ----------G---------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a           ------------------------------1.5b    Transcript 1 (1)
           Transcript 1 (2) -------------------Exon 1.4b  PDB: B:37-57 (gaps)  ------ Transcript 1 (2)
                1miu B    7 PVDLGLLEEDDEFEEFPAE-----------HVWEDNWDD----DDFSNQLRAELEKH   63
                                    16        |-         -|       |-   |    56       
                                             25          37      45   50             

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 5)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (4, 4)

Asymmetric Unit

(-) Gene Ontology  (67, 69)

Asymmetric Unit(hide GO term definitions)
Chain A   (BRCA2_MOUSE | P97929)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0010484    H3 histone acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + histone H3 = CoA + acetyl-histone H3.
    GO:0010485    H4 histone acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + histone H4 = CoA + acetyl-histone H4.
    GO:0043015    gamma-tubulin binding    Interacting selectively and non-covalently with the microtubule constituent protein gamma-tubulin.
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0003697    single-stranded DNA binding    Interacting selectively and non-covalently with single-stranded DNA.
biological process
    GO:0006978    DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator    A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, resulting in the induction of the transcription of p21 (also known as WAF1, CIP1 and SDI1) or any equivalent protein, in response to the detection of DNA damage.
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0007420    brain development    The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
    GO:0007569    cell aging    An aging process that has as participant a cell after a cell has stopped dividing. Cell aging may occur when a cell has temporarily stopped dividing through cell cycle arrest (GO:0007050) or when a cell has permanently stopped dividing, in which case it is undergoing cellular senescence (GO:0090398). May precede cell death (GO:0008219) and succeed cell maturation (GO:0048469).
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0051298    centrosome duplication    The replication of a centrosome, a structure comprised of a pair of centrioles and peri-centriolar material from which a microtubule spindle apparatus is organized.
    GO:0043009    chordate embryonic development    The process whose specific outcome is the progression of the embryo over time, from zygote formation through a stage including a notochord and neural tube until birth or egg hatching.
    GO:0031052    chromosome breakage    Regulated cleavage of the developing macronuclear genome at a limited number of chromosome breakage sites (CBS). The macronuclear destined segment (MDS) sequence adjacent to the CBS (or separated from it by a BES) receives a macronuclear telomere following chromosome breakage.
    GO:0051276    chromosome organization    A process that is carried out at the cellular level that results in the assembly, arrangement of constituent parts, or disassembly of chromosomes, structures composed of a very long molecule of DNA and associated proteins that carries hereditary information. This term covers covalent modifications at the molecular level as well as spatial relationships among the major components of a chromosome.
    GO:0000910    cytokinesis    The division of the cytoplasm and the plasma membrane of a cell and its partitioning into two daughter cells.
    GO:0006302    double-strand break repair    The repair of double-strand breaks in DNA via homologous and nonhomologous mechanisms to reform a continuous DNA helix.
    GO:0000724    double-strand break repair via homologous recombination    The error-free repair of a double-strand break in DNA in which the broken DNA molecule is repaired using homologous sequences. A strand in the broken DNA searches for a homologous region in an intact chromosome to serve as the template for DNA synthesis. The restoration of two intact DNA molecules results in the exchange, reciprocal or nonreciprocal, of genetic material between the intact DNA molecule and the broken DNA molecule.
    GO:0070200    establishment of protein localization to telomere    The directed movement of a protein to a specific location in the telomeric region of a chromosome.
    GO:0008585    female gonad development    The process whose specific outcome is the progression of the female gonad over time, from its formation to the mature structure.
    GO:0030097    hemopoiesis    The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates.
    GO:0043966    histone H3 acetylation    The modification of histone H3 by the addition of an acetyl group.
    GO:0043967    histone H4 acetylation    The modification of histone H4 by the addition of an acetyl group.
    GO:0031619    homologous chromosome orientation involved in meiotic metaphase I plate congression    The cell cycle process in which the sister centromeres of one chromosome attach to microtubules that emanate from the same spindle pole, which ensures that homologous maternal and paternal chromosomes are pulled in opposite directions at anaphase of meiosis I.
    GO:0001833    inner cell mass cell proliferation    The proliferation of cells in the inner cell mass.
    GO:0008630    intrinsic apoptotic signaling pathway in response to DNA damage    A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
    GO:0042771    intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator    A series of molecular signals in which an intracellular signal is conveyed to trigger the apoptotic death of a cell. The pathway is induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage, and ends when the execution phase of apoptosis is triggered.
    GO:0007141    male meiosis I    A cell cycle process comprising the steps by which a cell progresses through male meiosis I, the first meiotic division in the male germline.
    GO:0030879    mammary gland development    The process whose specific outcome is the progression of the mammary gland over time, from its formation to the mature structure. The mammary gland is a large compound sebaceous gland that in female mammals is modified to secrete milk. Its development starts with the formation of the mammary line and ends as the mature gland cycles between nursing and weaning stages.
    GO:1990426    mitotic recombination-dependent replication fork processing    Replication fork processing that includes recombination between DNA near the arrested fork and homologous sequences. Proteins involved in homologous recombination are required for replication restart.
    GO:0035264    multicellular organism growth    The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
    GO:0033600    negative regulation of mammary gland epithelial cell proliferation    Any process that stops, prevents or reduces the rate or extent of mammary gland epithelial cell proliferation.
    GO:0006289    nucleotide-excision repair    A DNA repair process in which a small region of the strand surrounding the damage is removed from the DNA helix as an oligonucleotide. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase. Nucleotide excision repair recognizes a wide range of substrates, including damage caused by UV irradiation (pyrimidine dimers and 6-4 photoproducts) and chemicals (intrastrand cross-links and bulky adducts).
    GO:0001556    oocyte maturation    A developmental process, independent of morphogenetic (shape) change, that is required for an oocyte to attain its fully functional state. Oocyte maturation commences after reinitiation of meiosis commonly starting with germinal vesicle breakdown, and continues up to the second meiotic arrest prior to fertilization.
    GO:0045931    positive regulation of mitotic cell cycle    Any process that activates or increases the rate or extent of progression through the mitotic cell cycle.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:0032465    regulation of cytokinesis    Any process that modulates the frequency, rate or extent of the division of the cytoplasm of a cell and its separation into two daughter cells.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0048478    replication fork protection    Any process that prevents the collapse of stalled replication forks.
    GO:0010225    response to UV-C    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a UV-C radiation stimulus. UV-C radiation (UV-C light) spans the wavelengths 100 to 280 nm.
    GO:0010165    response to X-ray    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of X-ray radiation. An X-ray is a form of electromagnetic radiation with a wavelength in the range of 10 nanometers to 100 picometers (corresponding to frequencies in the range 30 PHz to 3 EHz).
    GO:0032355    response to estradiol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
    GO:0010332    response to gamma radiation    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gamma radiation stimulus. Gamma radiation is a form of electromagnetic radiation (EMR) or light emission of a specific frequency produced from sub-atomic particle interaction, such as electron-positron annihilation and radioactive decay. Gamma rays are generally characterized as EMR having the highest frequency and energy, and also the shortest wavelength, within the electromagnetic radiation spectrum.
    GO:0007584    response to nutrient    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nutrient stimulus.
    GO:0007283    spermatogenesis    The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
    GO:0000722    telomere maintenance via recombination    Any recombinational process that contributes to the maintenance of proper telomeric length.
cellular component
    GO:0033593    BRCA2-MAGE-D1 complex    A heterodimeric protein complex formed of BRCA2 and MAGE-D1; may mediate the synergistic activities of the two proteins in regulating cell growth.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005815    microtubule organizing center    An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
    GO:0000784    nuclear chromosome, telomeric region    The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:0030141    secretory granule    A small subcellular vesicle, surrounded by a membrane, that is formed from the Golgi apparatus and contains a highly concentrated protein destined for secretion. Secretory granules move towards the periphery of the cell and upon stimulation, their membranes fuse with the cell membrane, and their protein load is exteriorized. Processing of the contained protein may take place in secretory granules.

Chain B   (SEM1_HUMAN | P60896)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0000724    double-strand break repair via homologous recombination    The error-free repair of a double-strand break in DNA in which the broken DNA molecule is repaired using homologous sequences. A strand in the broken DNA searches for a homologous region in an intact chromosome to serve as the template for DNA synthesis. The restoration of two intact DNA molecules results in the exchange, reciprocal or nonreciprocal, of genetic material between the intact DNA molecule and the broken DNA molecule.
    GO:0006406    mRNA export from nucleus    The directed movement of mRNA from the nucleus to the cytoplasm.
    GO:0043248    proteasome assembly    The aggregation, arrangement and bonding together of a mature, active proteasome complex.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0032039    integrator complex    A protein complex that stably associates with the C-terminus of RNA polymerase II and mediates 3'-end processing of small nuclear RNAs generated by RNA polymerase II.
    GO:0000502    proteasome complex    A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
    GO:0008541    proteasome regulatory particle, lid subcomplex    The subcomplex of the proteasome regulatory particle that forms the peripheral lid, which is added on top of the base subcomplex.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1miu)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1miu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BRCA2_MOUSE | P97929
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  SEM1_HUMAN | P60896
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BRCA2_MOUSE | P97929
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SEM1_HUMAN | P60896
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BRCA2_MOUSE | P979291mje
        SEM1_HUMAN | P608961iyj 1mje 3t5x 5gjq 5gjr 5l4k 5ln3 5m32 5t0c 5t0g 5t0h 5t0i 5t0j

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1MIU)