Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG ID IR21)
 
Authors :  K. Das, R. Xiao, T. Acton, G. Montelione, E. Arnold, Northeast Structural Genomics Consortium (Nesg)
Date :  14 Jun 02  (Deposition) - 04 Sep 02  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  D-Ribose 5-Phosphate Isomerase, Northeast Structural Genomics Consortium, Ir21, Haemophilus Influenzae, Structural Genomics, Psi, Protein Structure Initiative, Nesg (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Das, R. Xiao, T. Acton, G. Montelione, E. Arnold
D-Ribose-5-Phosphate Isomerase, Ir21
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RIBOSE-5-PHOSPHATE ISOMERASE A
    ChainsA, B
    EC Number5.3.1.6
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneRPIA
    Organism ScientificHAEMOPHILUS INFLUENZAE
    Organism Taxid727
    SynonymD-RIBOSE-5-PHOSPHATE ISOMERASE, PHOSPHORIBOISOMERASE A

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1CIT2Ligand/IonCITRIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:28 , GLY A:29 , SER A:30 , THR A:31 , ALA A:83 , ASP A:84 , LYS A:94 , GLY A:95 , GLY A:96 , GLY A:97 , GLU A:103 , HOH A:505 , HOH A:518 , HOH A:530 , HOH A:559 , HOH A:561 , HOH A:600 , HOH A:651BINDING SITE FOR RESIDUE CIT A 501
2AC2SOFTWARESER B:28 , GLY B:29 , SER B:30 , THR B:31 , ALA B:83 , ASP B:84 , LYS B:94 , GLY B:95 , GLY B:96 , GLY B:97 , GLU B:103 , HOH B:503 , HOH B:529 , HOH B:534 , HOH B:540BINDING SITE FOR RESIDUE CIT B 502

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1M0S)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1M0S)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1M0S)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1M0S)

(-) Exons   (0, 0)

(no "Exon" information available for 1M0S)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:219
 aligned with RPIA_HAEIN | P44725 from UniProtKB/Swiss-Prot  Length:219

    Alignment length:219
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210         
           RPIA_HAEIN     1 MNQLEMKKLAAQAALQYVKADTIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNPVEIEKELNNVAGVVTNGIFALRGADVVIVGTPEGAKVID 219
               SCOP domains d1m0sa1 A:1-126,A:199-219 D-ribose-5-phosphate isomerase (RpiA), catalytic domain                                             d1m0sa2 A:127-198 D-ribose-5-phosphate isomerase (RpiA), lid domain     d1m0sa1               SCOP domains
               CATH domains -1m0sA01 A:2-124,A:197-219  [code=3.40.50.1360, no name defined]                                                            1m0sA02 A:125-196  [code=3.30.70.260, no name defined]                  1m0sA01                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh....eeee..hhhhhhhhhhhhhhhhhh.eeee.hhhhhhhhhhh.....hhhhh..eeeeee...ee.....ee.....hhhhhhhhhhheeeeeeeee.hhh.........eeeee...hhhhhhhhhhhh..eeee..........eeeeee.....hhhhhhhhhhh...eeee.ee......eeeeee..eeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1m0s A   1 MNQLEMKKLAAQAALQYVKADRIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNPVEIEKELNNVAGVVTNGIFALRGADVVIVGTPEGAKVID 219
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210         

Chain B from PDB  Type:PROTEIN  Length:219
 aligned with RPIA_HAEIN | P44725 from UniProtKB/Swiss-Prot  Length:219

    Alignment length:219
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210         
           RPIA_HAEIN     1 MNQLEMKKLAAQAALQYVKADTIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNPVEIEKELNNVAGVVTNGIFALRGADVVIVGTPEGAKVID 219
               SCOP domains d1m0sb1 B:1-126,B:199-219 D-ribose-5-phosphate isomerase (RpiA), catalytic domain                                             d1m0sb2 B:127-198 D-ribose-5-phosphate isomerase (RpiA), lid domain     d1m0sb1               SCOP domains
               CATH domains -1m0sB01 B:2-124,B:197-219  [code=3.40.50.1360, no name defined]                                                            1m0sB02 B:125-196  [code=3.30.70.260, no name defined]                  1m0sB01                 CATH domains
           Pfam domains (1) ----------------------------------------------Rib_5-P_isom_A-1m0sB01 B:47-216                                                                                                                                           --- Pfam domains (1)
           Pfam domains (2) ----------------------------------------------Rib_5-P_isom_A-1m0sB02 B:47-216                                                                                                                                           --- Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhhhhh....eeee..hhhhhhhhhhhhhhhhhh.eeee.hhhhhhhhhhh...eehhhhh..eeeeee...ee.....ee.....hhhhhhhhhhheeeeeeeee.hhh.........eeeee...hhhhhhhhhhhh..eeee..........eeeeee.....hhhhhhhhhhh...eeee.ee......eeeeee..eeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1m0s B   1 MNQLEMKKLAAQAALQYVKADRIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNPVEIEKELNNVAGVVTNGIFALRGADVVIVGTPEGAKVID 219
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (RPIA_HAEIN | P44725)
molecular function
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0004751    ribose-5-phosphate isomerase activity    Catalysis of the reaction: D-ribose 5-phosphate = D-ribulose 5-phosphate.
biological process
    GO:0006098    pentose-phosphate shunt    The glucose-6-phosphate catabolic process in which, coupled to NADPH synthesis, glucose-6-P is oxidized with the formation of carbon dioxide (CO2) and ribulose 5-phosphate; ribulose 5-P then enters a series of reactions interconverting sugar phosphates. The pentose phosphate pathway is a major source of reducing equivalents for biosynthesis reactions and is also important for the conversion of hexoses to pentoses.
    GO:0009052    pentose-phosphate shunt, non-oxidative branch    The branch of the pentose-phosphate shunt which does not involve oxidation reactions. It comprises a series of sugar phosphate interconversions, starting with ribulose 5-P and producing fructose 6-P and glyceraldehyde 3-P.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CIT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1m0s)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1m0s
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RPIA_HAEIN | P44725
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.3.1.6
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RPIA_HAEIN | P44725
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1M0S)

(-) Related Entries Specified in the PDB File

1lkz 1LKZ IS THE CRYSTAL STRUCTURE OF D-RIBOSE-5-PHOSPHATE ISOMERASE (RPIA)
ir21