|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1LM0) |
Sites (0, 0)| (no "Site" information available for 1LM0) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1LM0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1LM0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1LM0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1LM0) |
Exons (0, 0)| (no "Exon" information available for 1LM0) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:101 aligned with CCME_SHEON | Q8EK44 from UniProtKB/Swiss-Prot Length:161 Alignment length:101 41 51 61 71 81 91 101 111 121 131 CCME_SHEON 32 SNLNLFYTPSEIVNGKTDTGVKPEAGQRIRVGGMVTVGSMVRDPNSLHVQFAVHDSLGGEILVTYDDLLPDLFREGQGIVAQGVLGEDGKLAATEVLAKHD 132 SCOP domains d1lm0a_ A: Heme chaperone CcmE SCOP domains CATH domains 1lm0A00 A:32-132 Nucleic acid-binding proteins CATH domains Pfam domains CcmE-1lm0A01 A:32-132 Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------- Transcript 1lm0 A 32 SNLNLFYTPSEIVNGKTDTGVKPEAGQRIRVGGMVTVGSMVRDPNSLHVQFAVHDSLGGEILVTYDDLLPDLFREGQGIVAQGVLGEDGKLAATEVLAKHD 132 41 51 61 71 81 91 101 111 121 131
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (CCME_SHEON | Q8EK44)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|