Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF R-PHYCOERYTHRIN FROM POLYSIPHONIA AT 2.8 A RESOLUTION
 
Authors :  D. C. Liang, T. Jiang, W. R. Chang
Date :  29 Jan 96  (Deposition) - 29 Jul 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B,K,L
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  K,L  (1x)
Biol. Unit 3:  A,B,K,L  (3x)
Biol. Unit 4:  A,B  (3x)
Biol. Unit 5:  K,L  (3x)
Biol. Unit 6:  A,B,K,L  (1x)
Keywords :  Light Harvesting Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  W. R. Chang, T. Jiang, Z. L. Wan, J. P. Zhang, Z. X. Yang, D. C. Liang
Crystal Structure Of R-Phycoerythrin From Polysiphonia Urceolata At 2. 8 A Resolution.
J. Mol. Biol. V. 262 721 1996
PubMed-ID: 8876649  |  Reference-DOI: 10.1006/JMBI.1996.0547
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - R-PHYCOERYTHRIN
    Chains: A, K
    Organism Scientific: POLYSIPHONIA URCEOLATA
    Organism Taxid: 65404
 
Molecule 2 - R-PHYCOERYTHRIN
    Chains: B, L
    Organism Scientific: POLYSIPHONIA URCEOLATA
    Organism Taxid: 65404

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABKL
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   KL
Biological Unit 3 (3x): ABKL
Biological Unit 4 (3x): AB  
Biological Unit 5 (3x):   KL
Biological Unit 6 (1x): ABKL

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 10)

Asymmetric Unit (2, 10)
No.NameCountTypeFull Name
1CYC8Ligand/IonPHYCOCYANOBILIN
2PUB2Ligand/IonPHYCOUROBILIN
Biological Unit 1 (2, 5)
No.NameCountTypeFull Name
1CYC4Ligand/IonPHYCOCYANOBILIN
2PUB1Ligand/IonPHYCOUROBILIN
Biological Unit 2 (2, 5)
No.NameCountTypeFull Name
1CYC4Ligand/IonPHYCOCYANOBILIN
2PUB1Ligand/IonPHYCOUROBILIN
Biological Unit 3 (2, 30)
No.NameCountTypeFull Name
1CYC24Ligand/IonPHYCOCYANOBILIN
2PUB6Ligand/IonPHYCOUROBILIN
Biological Unit 4 (2, 15)
No.NameCountTypeFull Name
1CYC12Ligand/IonPHYCOCYANOBILIN
2PUB3Ligand/IonPHYCOUROBILIN
Biological Unit 5 (2, 15)
No.NameCountTypeFull Name
1CYC12Ligand/IonPHYCOCYANOBILIN
2PUB3Ligand/IonPHYCOUROBILIN
Biological Unit 6 (2, 10)
No.NameCountTypeFull Name
1CYC8Ligand/IonPHYCOCYANOBILIN
2PUB2Ligand/IonPHYCOUROBILIN

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREALA A:74 , LYS A:80 , LYS A:83 , CYS A:84 , ARG A:86 , ASP A:87 , HIS A:90 , TRP A:110 , LEU A:122 , PRO A:125 , TYR A:129 , HOH A:185 , TYR B:76 , THR B:77 , ASN B:78 , MET B:81BINDING SITE FOR RESIDUE CYC A 175
02AC2SOFTWAREGLU A:54 , ARG A:139 , LEU A:140 , CYS A:140A , ARG A:140D , ASP A:143 , MET A:144BINDING SITE FOR RESIDUE CYC A 141
03AC3SOFTWAREMET B:59 , ASN B:72 , CYS B:75 , ARG B:79 , ARG B:80 , ALA B:83 , CYS B:84 , ARG B:86 , ASP B:87 , ILE B:90 , ARG B:110 , PRO B:125 , THR B:129BINDING SITE FOR RESIDUE CYC B 175
04AC4SOFTWAREGLN A:28 , ASN B:35 , LYS B:36 , ASP B:39 , ILE B:144 , SER B:145 , VAL B:150 , ILE B:151 , GLU B:152 , GLY B:153 , CYS B:155 , HOH B:190 , ARG K:33 , GLN K:147BINDING SITE FOR RESIDUE CYC B 176
05AC5SOFTWARECYS B:50 , ASP B:54 , GLY B:58 , CYS B:61 , ILE B:135 , ALA B:138 , CYS B:142 , PHE B:143 , ALA B:148 , SER B:148A , GLN B:148B , ARG B:148CBINDING SITE FOR RESIDUE PUB B 177
06AC6SOFTWAREPHE K:60 , ALA K:74 , GLY K:75 , LYS K:80 , LYS K:83 , CYS K:84 , ARG K:86 , ASP K:87 , TRP K:110 , LEU K:122 , LEU K:124 , PRO K:125 , TYR K:129 , ILE L:67 , TYR L:76 , THR L:77 , MET L:81BINDING SITE FOR RESIDUE CYC K 175
07AC7SOFTWAREASN K:47 , VAL K:51 , GLU K:54 , THR K:136 , ARG K:139 , CYS K:140A , ARG K:140D , ASP K:143 , HOH K:200 , SER L:145 , THR L:147 , GLY L:153 , ASP L:154 , CYS L:155 , SER L:156 , CYC L:176BINDING SITE FOR RESIDUE CYC K 141
08AC8SOFTWARECYS L:50 , ASP L:54 , GLY L:58 , CYS L:61 , GLU L:62 , ARG L:131 , ILE L:135 , ALA L:138 , ALA L:139 , CYS L:142 , PHE L:143 , ALA L:148 , SER L:149A , GLN L:149BBINDING SITE FOR RESIDUE PUB L 175
09AC9SOFTWAREGLN A:147 , GLN K:28 , CYC K:141 , ASN L:35 , LYS L:36 , LEU L:38 , ASP L:39 , ILE L:144 , ASN L:146 , ILE L:151 , GLY L:153 , CYS L:155BINDING SITE FOR RESIDUE CYC L 176
10BC1SOFTWAREMET L:59 , ASN L:72 , CYS L:75 , ARG L:79 , ARG L:80 , ALA L:83 , CYS L:84 , ARG L:86 , ASP L:87 , ARG L:110 , LEU L:122 , VAL L:124 , PRO L:125 , THR L:129BINDING SITE FOR RESIDUE CYC L 177

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1LIA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1LIA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1LIA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1LIA)

(-) Exons   (0, 0)

(no "Exon" information available for 1LIA)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:164
 aligned with PHEA_POLHB | Q01921 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:164
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160    
          PHEA_POLHB      1 MKSVITTTISAADAAGRYPSTSDLQSVQGNIQRAAARLEAAEKLGSNHEAVVKEAGDACFSKYGYLKNPGEAGENQEKINKCYRDIDHYMRLINYTLVVGGTGPLDEWGIAGAREVYRTLNLPSAAYIAAFVFTRDRLCIPRDMSAQAGVEFCTALDYLINSLS  164
               SCOP domains d1liaa_ A: Phycoerythrin alpha subunit                                                                                                                               SCOP domains
               CATH domains 1liaA00 A:1-174 Phycocyanins                                                                                                                                         CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhh........hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhh...hhhhhhh....hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1lia A    1 MKSVITTTISAADAAGRYPSTSDLQSVQGNIQRAAARLEAAEKLGSNHEAVVKEAGDACFSKYGYNKNPGEAGENQEKINKCYRDIDHYMRLINYTLVVGGTGPLDEWGIAGAREVYRTLNLPSAAYIAAFVFTRDRLCIPRDMSAQAGVEFCTALDYLINSLS  174
                                    10        20        30        40        50        60     || 72        82        92       102       112       122       132      140B|||    150|      170    
                                                                                            66|                                                                    140A||||    150|             
                                                                                             69                                                                     140B|||     161             
                                                                                                                                                                     140C||                     
                                                                                                                                                                      140D|                     
                                                                                                                                                                        143                     


Chain A from PDB  Type:PROTEIN  Length:164
 aligned with PHEA_POLUR | P84861 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:164
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160    
          PHEA_POLUR      1 MKSVITTTISAADAAGRYPSTSDLQSVQGNIQRAAARLEAAEKLGSNHEAVVKEAGDACFSKYGYNKNPGEAGENQEKINKCYRDIDHYMRLINYTLVVGGTGPLDEWGIAGAREVYRTLNLPSAAYIAAFVFTRDRLCIPRDMSAQAGVEFCTALDYLINSLS  164
               SCOP domains d1liaa_ A: Phycoerythrin alpha subunit                                                                                                                               SCOP domains
               CATH domains 1liaA00 A:1-174 Phycocyanins                                                                                                                                         CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhh........hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhh...hhhhhhh....hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1lia A    1 MKSVITTTISAADAAGRYPSTSDLQSVQGNIQRAAARLEAAEKLGSNHEAVVKEAGDACFSKYGYNKNPGEAGENQEKINKCYRDIDHYMRLINYTLVVGGTGPLDEWGIAGAREVYRTLNLPSAAYIAAFVFTRDRLCIPRDMSAQAGVEFCTALDYLINSLS  174
                                    10        20        30        40        50        60     || 72        82        92       102       112       122       132      140B|||    150|      170    
                                                                                            66|                                                                    140A||||    150|             
                                                                                             69                                                                     140B|||     161             
                                                                                                                                                                     140C||                     
                                                                                                                                                                      140D|                     
                                                                                                                                                                        143                     


Chain B from PDB  Type:PROTEIN  Length:177
 aligned with PHEB_POLHB | Q01922 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:177
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       
          PHEB_POLHB      1 MLDAFSRVVVNSDSKAAYVSGSDLQALKTFINDGNKRLDAVNYIVSNSSCIVSDAISGMICENPGLITPGGNCYTNRRMAACLRDGEIILRYVSYALLAGDASVLEDRCLNGLKETYIALGVPTNSTVRAVSIMKAAAVCFISNTASQRKVEVIEGDCSALASEVASYCDRVVAAVS  177
               SCOP domains d1liab_ B: Phycoerythrin beta subunit                                                                                                                                             SCOP domains
               CATH domains 1liaB00 B:1-174 Phycocyanins                                                                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhh.........hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh....hhhhhhhh...hhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1lia B    1 MLDAFSRVVVNSDSKAAYVSGSDLQALKTFINDGNKRLDAVNYIVSNSSCIVSDAISGMICENPGLITPGGNCYTNRRMAACLRDGEIILRYVSYALLAGDASVLEDRCLNGLKETYIALGVPTNSTVRAVSIMKAAAVCFISNTASQRKVEVIEGDCSALASEVASYCDRVVAAVS  174
                                    10        20        30        40        50        60        70 ||     82        92       102       112       122       132       142      148D|      157       167       
                                                                                                  72|                                                                      148A||||                          
                                                                                                   75                                                                       148B|||                          
                                                                                                                                                                             148C||                          
                                                                                                                                                                              148D|                          
                                                                                                                                                                               148E                          


Chain B from PDB  Type:PROTEIN  Length:177
 aligned with PHEB_POLUR | P84862 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:177
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       
          PHEB_POLUR      1 MLDAFSRVVVNSDSKAAYVSGSDLQALKTFINDGNKRLDAVNYIVSNSSCIVSDAISGMICENPGLITPGGNCYTNRRMAACLRDGEIILRYVSYALLAGDASVLEDRCLNGLKETYIALGVPTNSTVRAVSIMKAAAVCFISNTASQRKVEVIEGDCSALASEVASYCDRVVAAVS  177
               SCOP domains d1liab_ B: Phycoerythrin beta subunit                                                                                                                                             SCOP domains
               CATH domains 1liaB00 B:1-174 Phycocyanins                                                                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhh........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhh.........hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh....hhhhhhhh...hhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1lia B    1 MLDAFSRVVVNSDSKAAYVSGSDLQALKTFINDGNKRLDAVNYIVSNSSCIVSDAISGMICENPGLITPGGNCYTNRRMAACLRDGEIILRYVSYALLAGDASVLEDRCLNGLKETYIALGVPTNSTVRAVSIMKAAAVCFISNTASQRKVEVIEGDCSALASEVASYCDRVVAAVS  174
                                    10        20        30        40        50        60        70 ||     82        92       102       112       122       132       142      148D|      157       167       
                                                                                                  72|                                                                      148A||||                          
                                                                                                   75                                                                       148B|||                          
                                                                                                                                                                             148C||                          
                                                                                                                                                                              148D|                          
                                                                                                                                                                               148E                          


Chain K from PDB  Type:PROTEIN  Length:164
 aligned with PHEA_POLHB | Q01921 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:164
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160    
          PHEA_POLHB      1 MKSVITTTISAADAAGRYPSTSDLQSVQGNIQRAAARLEAAEKLGSNHEAVVKEAGDACFSKYGYLKNPGEAGENQEKINKCYRDIDHYMRLINYTLVVGGTGPLDEWGIAGAREVYRTLNLPSAAYIAAFVFTRDRLCIPRDMSAQAGVEFCTALDYLINSLS  164
               SCOP domains d1liak_ K: Phycoerythrin alpha subunit                                                                                                                               SCOP domains
               CATH domains 1liaK00 K:1-174 Phycocyanins                                                                                                                                         CATH domains
           Pfam domains (1) -----Phycobilisome-1liaK01 K:6-174                                                                                                                                   Pfam domains (1)
           Pfam domains (2) -----Phycobilisome-1liaK02 K:6-174                                                                                                                                   Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhh........hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh....hhhhhhh....hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1lia K    1 MKSVITTTISAADAAGRYPSTSDLQSVQGNIQRAAARLEAAEKLGSNHEAVVKEAGDACFSKYGYNKNPGEAGENQEKINKCYRDIDHYMRLINYTLVVGGTGPLDEWGIAGAREVYRTLNLPSAAYIAAFVFTRDRLCIPRDMSAQAGVEFCTALDYLINSLS  174
                                    10        20        30        40        50        60     || 72        82        92       102       112       122       132      140B|||    150|      170    
                                                                                            66|                                                                    140A||||    150|             
                                                                                             69                                                                     140B|||     161             
                                                                                                                                                                     140C||                     
                                                                                                                                                                      140D|                     
                                                                                                                                                                        143                     


Chain K from PDB  Type:PROTEIN  Length:164
 aligned with PHEA_POLUR | P84861 from UniProtKB/Swiss-Prot  Length:164

    Alignment length:164
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160    
          PHEA_POLUR      1 MKSVITTTISAADAAGRYPSTSDLQSVQGNIQRAAARLEAAEKLGSNHEAVVKEAGDACFSKYGYNKNPGEAGENQEKINKCYRDIDHYMRLINYTLVVGGTGPLDEWGIAGAREVYRTLNLPSAAYIAAFVFTRDRLCIPRDMSAQAGVEFCTALDYLINSLS  164
               SCOP domains d1liak_ K: Phycoerythrin alpha subunit                                                                                                                               SCOP domains
               CATH domains 1liaK00 K:1-174 Phycocyanins                                                                                                                                         CATH domains
           Pfam domains (1) -----Phycobilisome-1liaK01 K:6-174                                                                                                                                   Pfam domains (1)
           Pfam domains (2) -----Phycobilisome-1liaK02 K:6-174                                                                                                                                   Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh.hhhh........hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh....hhhhhhh....hhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1lia K    1 MKSVITTTISAADAAGRYPSTSDLQSVQGNIQRAAARLEAAEKLGSNHEAVVKEAGDACFSKYGYNKNPGEAGENQEKINKCYRDIDHYMRLINYTLVVGGTGPLDEWGIAGAREVYRTLNLPSAAYIAAFVFTRDRLCIPRDMSAQAGVEFCTALDYLINSLS  174
                                    10        20        30        40        50        60     || 72        82        92       102       112       122       132      140B|||    150|      170    
                                                                                            66|                                                                    140A||||    150|             
                                                                                             69                                                                     140B|||     161             
                                                                                                                                                                     140C||                     
                                                                                                                                                                      140D|                     
                                                                                                                                                                        143                     


Chain L from PDB  Type:PROTEIN  Length:177
 aligned with PHEB_POLHB | Q01922 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:177
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       
          PHEB_POLHB      1 MLDAFSRVVVNSDSKAAYVSGSDLQALKTFINDGNKRLDAVNYIVSNSSCIVSDAISGMICENPGLITPGGNCYTNRRMAACLRDGEIILRYVSYALLAGDASVLEDRCLNGLKETYIALGVPTNSTVRAVSIMKAAAVCFISNTASQRKVEVIEGDCSALASEVASYCDRVVAAVS  177
               SCOP domains d1lial_ L: Phycoerythrin beta subunit                                                                                                                                             SCOP domains
               CATH domains 1liaL00 L:1-174 Phycocyanins                                                                                                                                                      CATH domains
           Pfam domains (1) -----Phycobilisome-1liaL01 L:6-174                                                                                                                                                Pfam domains (1)
           Pfam domains (2) -----Phycobilisome-1liaL02 L:6-174                                                                                                                                                Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhh.....hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhh.........hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh....hhhhhhhh...hhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1lia L    1 MLDAFSRVVVNSDSKAAYVSGSDLQALKTFINDGNKRLDAVNYIVSNSSCIVSDAISGMICENPGLITPGGNCYTNRRMAACLRDGEIILRYVSYALLAGDASVLEDRCLNGLKETYIALGVPTNSTVRAVSIMKAAAVCFISNTASQRKVEVIEGDCSALASEVASYCDRVVAAVS  174
                                    10        20        30        40        50        60        70 ||     82        92       102       112       122       132       142      149D|      157       167       
                                                                                                  72|                                                                      149A||||                          
                                                                                                   75                                                                       149B|||                          
                                                                                                                                                                             149C||                          
                                                                                                                                                                              149D|                          
                                                                                                                                                                               149E                          


Chain L from PDB  Type:PROTEIN  Length:177
 aligned with PHEB_POLUR | P84862 from UniProtKB/Swiss-Prot  Length:177

    Alignment length:177
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       
          PHEB_POLUR      1 MLDAFSRVVVNSDSKAAYVSGSDLQALKTFINDGNKRLDAVNYIVSNSSCIVSDAISGMICENPGLITPGGNCYTNRRMAACLRDGEIILRYVSYALLAGDASVLEDRCLNGLKETYIALGVPTNSTVRAVSIMKAAAVCFISNTASQRKVEVIEGDCSALASEVASYCDRVVAAVS  177
               SCOP domains d1lial_ L: Phycoerythrin beta subunit                                                                                                                                             SCOP domains
               CATH domains 1liaL00 L:1-174 Phycocyanins                                                                                                                                                      CATH domains
           Pfam domains (1) -----Phycobilisome-1liaL01 L:6-174                                                                                                                                                Pfam domains (1)
           Pfam domains (2) -----Phycobilisome-1liaL02 L:6-174                                                                                                                                                Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhh.....hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhh.........hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh....hhhhhhhh...hhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1lia L    1 MLDAFSRVVVNSDSKAAYVSGSDLQALKTFINDGNKRLDAVNYIVSNSSCIVSDAISGMICENPGLITPGGNCYTNRRMAACLRDGEIILRYVSYALLAGDASVLEDRCLNGLKETYIALGVPTNSTVRAVSIMKAAAVCFISNTASQRKVEVIEGDCSALASEVASYCDRVVAAVS  174
                                    10        20        30        40        50        60        70 ||     82        92       102       112       122       132       142      149D|      157       167       
                                                                                                  72|                                                                      149A||||                          
                                                                                                   75                                                                       149B|||                          
                                                                                                                                                                             149C||                          
                                                                                                                                                                              149D|                          
                                                                                                                                                                               149E
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: Globin (291)

(-) Gene Ontology  (9, 36)

Asymmetric Unit(hide GO term definitions)
Chain A,K   (PHEA_POLHB | Q01921)
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0009507    chloroplast    A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
    GO:0009535    chloroplast thylakoid membrane    The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030089    phycobilisome    Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.
    GO:0009536    plastid    Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain A,K   (PHEA_POLUR | P84861)
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0009507    chloroplast    A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
    GO:0009535    chloroplast thylakoid membrane    The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030089    phycobilisome    Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.
    GO:0009536    plastid    Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain B,L   (PHEB_POLHB | Q01922)
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0009507    chloroplast    A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
    GO:0009535    chloroplast thylakoid membrane    The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030089    phycobilisome    Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.
    GO:0009536    plastid    Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

Chain B,L   (PHEB_POLUR | P84862)
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0009507    chloroplast    A chlorophyll-containing plastid with thylakoids organized into grana and frets, or stroma thylakoids, and embedded in a stroma.
    GO:0009535    chloroplast thylakoid membrane    The pigmented membrane of a chloroplast thylakoid. An example of this component is found in Arabidopsis thaliana.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0030089    phycobilisome    Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.
    GO:0009536    plastid    Any member of a family of organelles found in the cytoplasm of plants and some protists, which are membrane-bounded and contain DNA. Plant plastids develop from a common type, the proplastid.
    GO:0009579    thylakoid    A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CYC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PUB  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1lia)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format | Biol. Unit 5 PNG format | Biol. Unit 6 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1lia
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PHEA_POLHB | Q01921
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PHEA_POLUR | P84861
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PHEB_POLHB | Q01922
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  PHEB_POLUR | P84862
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PHEA_POLHB | Q01921
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PHEA_POLUR | P84861
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PHEB_POLHB | Q01922
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PHEB_POLUR | P84862
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PHEA_POLUR | P84861: 3mwn

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1LIA)