|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric Unit (3, 3) Biological Unit 1 (1, 2) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1LEM) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1LEM) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1LEM) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:181 aligned with LEC_LENCU | P02870 from UniProtKB/Swiss-Prot Length:275 Alignment length:181 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210 LEC_LENCU 31 TETTSFSITKFSPDQKNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADEFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYPN 211 SCOP domains d1lem.1 A:,B: Legume lectin SCOP domains CATH domains 1lemA00 A:1-181 [code=2.60.120.200, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------LECTIN_----------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1lem A 1 TETTSFSITKFSPDQQNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYPN 181 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 Chain B from PDB Type:PROTEIN Length:47 aligned with LEC_LENCU | P02870 from UniProtKB/Swiss-Prot Length:275 Alignment length:47 227 237 247 257 LEC_LENCU 218 VTSYTLNEVVPLKDVVPEWVRIGFSATTGAEFAAHEVHSWSFHSELG 264 SCOP domains d1lem.1 A:,B: Legume lectin SCOP domains CATH domains ----------------------------------------------- CATH domains Pfam domains ----------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------- SAPs(SNPs) PROSITE ---------------LECTIN_LEG---------------------- PROSITE Transcript ----------------------------------------------- Transcript 1lem B 1 VTSYTLNEVVPLKDVVPEWVRIGFSATTGAEFAAQEVHSWSFNSQLG 47 10 20 30 40
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1LEM) |
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A,B (LEC_LENCU | P02870)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|