|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 4) Biological Unit 1 (3, 8) |
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 1LA6) |
(no "Cis Peptide Bond" information available for 1LA6) |
(no "SAP(SNP)/Variant" information available for 1LA6) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 1LA6) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:143 aligned with HBA1_TRENE | P45718 from UniProtKB/Swiss-Prot Length:142 Alignment length:143 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 HBA1_TRENE - -SLSDKDKAAVRALWSKIGKSSDAIGNDALSRMIVVYPQTKIYFSHWPDVTPGSPNIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPSNFKILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR 142 SCOP domains d1la6a_ A: Hemoglobin, alpha-chain SCOP domains CATH domains -1la6A00 A:1-142 Globins CATH domains Pfam domains ------Globin-1la6A01 A:6-107 ----------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --GLOBIN PDB: A:2-142 UniProt: 2-142 PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1la6 A 0 xSLSDKDKAAVRALWSKIGKSSDAIGNDALSRMIVVYPQTKIYFSHWPDVTPGSPNIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPSNFKILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR 142 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 | 0-ACE Chain B from PDB Type:PROTEIN Length:132 aligned with HBB_TRENE | P45720 from UniProtKB/Swiss-Prot Length:146 Alignment length:143 10 20 30 40 50 60 70 80 90 100 110 120 130 140 HBB_TRENE 1 VEWTDKERSIISDIFSHMDYDDIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSNANVAAHGIKVLHGLDRGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAAVVSALGK 143 SCOP domains d1la6b_ B: Hemoglobin, beta-chain SCOP domains CATH domains 1la6B00 B:1-143 Globins CATH domains Pfam domains ------Globin-1la6B01 B:7-111 -------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) ---GLOBIN PDB: B:4-143 UniProt: 4-146 PROSITE (2) Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1la6 B 1 VEWTDKERSIISDIFSHMDYDDIGPKALSRCLVVYPWTQRYF-----------IMSNANVAAHGIKVLHGLDRGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAAVVSALGK 143 10 20 30 40 | - | 60 70 80 90 100 110 120 130 140 42 54
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A (HBA1_TRENE | P45718)
Chain B (HBB_TRENE | P45720)
|
|
|
|
|
|
|