Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF PLANT NSLTP2 PURIFIED FROM RICE (ORYZA SATIVA)
 
Authors :  D. Samuel, P. -C. Lyu
Date :  11 Mar 02  (Deposition) - 02 Oct 02  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Nsltp2, Plant Ltp, Lipid Transfer, Lipid Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Samuel, Y. J. Liu, C. S. Cheng, P. C. Lyu
Solution Structure Of Plant Nonspecific Lipid Transfer Protein-2 From Rice (Oryza Sativa).
J. Biol. Chem. V. 277 35267 2002
PubMed-ID: 12011089  |  Reference-DOI: 10.1074/JBC.M203113200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NON-SPECIFIC LIPID TRANSFER PROTEIN
    Chains: A
    Organism Common: RICE
    Organism Scientific: ORYZA SATIVA
    Organism Taxid: 4530
    Synonym: LTP2

 Structural Features

(-) Chains, Units

  
NMR Structure : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1L6H)

(-) Sites  (0, 0)

(no "Site" information available for 1L6H)

(-) SS Bonds  (4, 4)

NMR Structure
No.Residues
1A:3 -A:35
2A:11 -A:25
3A:26 -A:61
4A:37 -A:68

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1L6H)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1L6H)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1L6H)

(-) Exons   (0, 0)

(no "Exon" information available for 1L6H)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:69
 aligned with NLTPX_ORYSI | A2XBN5 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:69
                                    37        47        57        67        77        87         
           NLTPX_ORYSI   28 ASCNAGQLTVCAGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH 96
               SCOP domains d1l6ha_ A: Non-specific lipid-transfer protein homologue (ns-LTP2)    SCOP domains
               CATH domains 1l6hA00 A:1-69 Plant lipid-transfer and hydrophobic proteins          CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh...hhhhhh...hhhhh............ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                  1l6h A  1 AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH 69
                                    10        20        30        40        50        60         


Chain A from PDB  Type:PROTEIN  Length:69
 aligned with NLTPX_ORYSJ | Q10ST8 from UniProtKB/Swiss-Prot  Length:96

    Alignment length:69
                                    37        47        57        67        77        87         
           NLTPX_ORYSJ   28 AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH 96
               SCOP domains d1l6ha_ A: Non-specific lipid-transfer protein homologue (ns-LTP2)    SCOP domains
               CATH domains 1l6hA00 A:1-69 Plant lipid-transfer and hydrophobic proteins          CATH domains
               Pfam domains --------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh...hhhhhh...hhhhh............ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------- Transcript
                  1l6h A  1 AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH 69
                                    10        20        30        40        50        60
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1L6H)

(-) Gene Ontology  (2, 4)

NMR Structure(hide GO term definitions)
Chain A   (NLTPX_ORYSI | A2XBN5)
molecular function
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
biological process
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.

Chain A   (NLTPX_ORYSJ | Q10ST8)
molecular function
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
biological process
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1l6h)
 
  Sites
(no "Sites" information available for 1l6h)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1l6h)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1l6h
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NLTPX_ORYSI | A2XBN5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  NLTPX_ORYSJ | Q10ST8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  NLTPX_ORYSI | A2XBN5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  NLTPX_ORYSJ | Q10ST8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1L6H)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1L6H)